NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27130.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27130.1 Public Mus musculus 14 Adcy4 16 104 75 CCDS HistoryNCBI Gene:104110Re-query CCDS DB by CCDS ID:27130.1Re-query CCDS DB by GeneID:104110See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27130.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000002398 ENSMUSP00000002398 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000002398Link to Ensembl Protein Viewer:ENSMUSP00000002398Re-query CCDS DB by Nucleotide ID:ENSMUST00000002398Re-query CCDS DB by Protein ID:ENSMUSP00000002398
Original member Current member EBI,WTSI ENSMUST00000170223 ENSMUSP00000130530 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000170223Link to Ensembl Protein Viewer:ENSMUSP00000130530Re-query CCDS DB by Nucleotide ID:ENSMUST00000170223Re-query CCDS DB by Protein ID:ENSMUSP00000130530
Original member Current member NCBI NM_080435.1 NP_536683.1 Accepted alive Link to Nucleotide Sequence:NM_080435.1Link to Protein Sequence:NP_536683.1Re-query CCDS DB by Nucleotide ID:NM_080435Re-query CCDS DB by Protein ID:NP_536683Link to BLink:NP_536683.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_536683.1 1077 Q91WF3 1077 100% 0 0

Chromosomal Locations for CCDS 27130.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 55769141 55769287 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55769373 55769497 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55769792 55769906 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55770025 55770132 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55770372 55770518 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55771377 55771535 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55771955 55772039 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55772246 55772430 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55772661 55772786 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55773422 55773559 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55773666 55773750 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55774473 55774570 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55774969 55775038 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55775215 55775301 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55775414 55775448 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55777928 55778101 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55778281 55778413 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55778642 55778800 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55778935 55779062 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55779703 55779814 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55779897 55780045 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55780820 55780969 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55781580 55781741 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55781835 55782032 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55783520 55783678 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3234 nt):
ATGGCCCGCCTCTTCAGTCCCCGGCCTCCTCCCAGCGAAGATCTCTTCTACGAAACTTACTACAGCCTGA
GC
CAACAGTACCCACTGCTGATACTGCTTTTGGTCATTGTGCTCTGCGCGCTGGTGGCACTGCCCGCCGT
C
GCCTGGGCCAGCGGCAGGGAGCTGACCTCAGACCCAAGCTTCCTGACAACTGTGCTGTGTGCTTTGGGT
GGC
TTCTCTCTGCTATTGGGGCTTGCTTCCCGGGAGCAGCAACTGCAGCGATGGACACGACCTCTTTCTG
GT
CTCATATGGGTTGCATTACTGGCTCTGGGCTATGGATTTCTGTTCACTGGGGGTGTGGTGAGCGCCTG
G
GACCAGGTGTCTTTTTTCCTCTTCATCATCTTCACCGTGTACGCCATGCTGCCCTTGGGCATGCGGGAT
GCT
GCTGCTGCGGGAGTCATCTCATCCCTCTCGCACCTGCTGGTCCTTGGACTGTATCTTGGGTGGCAGC
CT
GAGTCACAGAGAGCTCTGCTACCACAGTTGGCAGCAAACGCGGTATTGTTCCTGTGTGGGAACGTGGT
G
GGAGCGTACCACAAGGCCCTGATGGAGCGAGCATTGCGGGCCACGTTCCGGGAGGCTCTTAGCTCTCTG
CAC
TCACGCCGGAGGCTGGACACTGAGAAAAAGCACCAGGAGCACCTCCTCTTGTCTATCCTTCCTGCCT
AC
CTGGCCCGAGAGATGAAAGCAGAGATCATGGCCCGGCTGCAGGCTGGACAGCGCTCACGGCCAGAGAA
C
ACAAACAACTTTCACAGCCTGTATGTCAAGAGGCACCAAGGAGTGAGTGTGCTGTATGCTGACATCGTG
GGC
TTCACGCGGCTGGCCAGCGAGTGTTCCCCGAAGGAGCTGGTGCTCATGCTGAATGAGCTCTTTGGCA
AG
TTCGACCAAATTGCCAAGGAGCACGAATGCATGCGGATCAAGATCCTGGGAGACTGTTACTACTGTGT
C
TCCGGGCTGCCCCTCTCGCTGCCTGACCACGCTATCAATTGTGTGCGCATGGGGCTGGACATGTGCCGG
GCC
ATCAGGAAACTTCGGGTAGCCACCGGTGTGGATATCAACATGCGTGTGGGCGTGCACTCGGGCAGCG
TT
CTCTGTGGAGTCATTGGGCTACAGAAGTGGCAGTATGATGTCTGGTCCCATGATGTCACATTGGCCAA
C
CATATGGAAGCAGGCGGTGTACCAGGACGAGTGCACATCACAGGGGCCACGCTGGCCCTGCTAGCAGGA
GCT
TATGCTGTGGAGAGGGCAGACACGGAACACCGAGACCCATACCTTCGGGAGCTAGGAGAACCTACAT
AC
CTGGTCATTGATCCTCGGGCTGAGGAGGAAGACGAGAAGGGCACCGCAAAAGGATTGCTGTCTTCTCT
G
GAGGGGCACACGATGCGTCCGTCACTACTGATGACTCGCTATCTGGAGTCTTGGGGTGCAGCCAAGCCT
TTC
GCCCACCTAAGCCACCTTGACAGTCCCGTGTCCACCTCCACTCCACTCCCGGAGAAAGCCTTCAGCC
CC
CAGTGGAGCCTGGACCGGAGTCGCACCCCCCGGGGACTAGATGATGAACTGGACACTGGTGATGCTAA
G
TTCTTCCAGGTCATCGAACAACTCAACTCTCAGAAACAGTGGAAGCAGTCGAAGGACTTCAACCTCCTG
ACG
CTGTACTTCAGAGAGAAGGAGATGGAGAAACAGTATCGGCTCTCTGCACTCCCCGCCTTCAAATACT
AC
GCAGCCTGCACCTTCCTGGTTTTTCTGTCCAACTTCACTATCCAAATGCTGGTGACAACCAGGCCCCC
A
GCTCTGATCATCACCTACAGCATCACCTTCCTTCTCTTCTTTCTCCTCCTCTTCGTCTGCTTCTCAGAG
CAC
CTGACGAAGTGTGTCCAGAAAGGTCCCAAGATGTTGCACTGGCTGCCTGCACTGTCTGTCCTGGTGG
CC
ACACGGCCAGGATTTCGAGTAGCCCTGGGTACGGCCACCATCCTCCTGGTATTCACTATGGCCATCGC
C
AGCCTGCTCTTCTTACCAGTGTCATCAGACTGCCTTTTCCTGGCTTCCAATGTGTCATCTGTGACTTTC
AAT
GCTTCCTGGGAGATGCCAGGATCCCTGCCCCTCATCAGCATCCCCCTCATCAGCATCCCATACTCCA
TG
CATTGCTGCGTGTTGGGTTTCCTCTCCTGCTCCCTTTTTCTGCACATGAGCTTCGAACTGAAGCTGCT
C
CTACTTCTGCTGTGGCTGGTGGCATCTTGTTCCCTATTTCTGCATTCCCACGCCTGGCTGTCTGACTGC
CTC
ATTGCCCGCCTTTATCAAAGCCCTTCGGACTCCAGACCAGGGGTACTGAAGGAACCCAAGCTGATGG
GA
GCGATCTACTTCTTCATCTTCTTCTTCACACTCCTGGTCCTGGCTCGGCAGAATGAGTATTACTGCCG
C
CTGGACTTCCTGTGGAAAAAGAAACTGAGGCAGGAGCGAGAGGAGACTGAGACAATGGAGAACCTGACC
CGG
CTCCTCCTGGAGAATGTACTCCCTGCACACGTGGCCCCCCAGTTCATCGGCCAGAACCGGCGCAATG
AG
GACCTCTACCACCAGTCGTACGAATGCGTTTGTGTCCTCTTCGCGTCGGTCCCAGACTTTAAGGAATT
C
TACTCTGAATCCAACATCAACCACGAGGGGCTGGAGTGCCTGCGGCTGCTCAATGAGATCATTGCTGAC
TTT
GATGAGCTGCTCTCCAAGCCAAAGTTCAGTGGAGTAGAGAAGATCAAAACTATTGGCAGTACCTACA
TG
GCGGCCACAGGCTTAAATGCCACCTCTGGACAGGATACTCAGCAGGATTCTGAGAGAAGCTGCAGTCA
T
CTGGGCACCATGGTGGAATTTGCAGTGGCCCTGGGGTCTAAGCTGGGAGTCATCAACAAGCACTCGTTC
AAT
AACTTCCGCCTGCGTGTGGGGTTGAACCACGGACCAGTAGTAGCAGGGGTGATTGGGGCGCAGAAGC
CA
CAGTACGACATCTGGGGGAACACAGTGAATGTGGCCAGCCGAATGGAGAGCACAGGCGTTCTCGGCAA
G
ATCCAAGTGACTGAGGAGACAGCGCGGGCCCTGCAGTCCCTGGGTTACACGTGCTATAGCAGAGGCAGC
ATC
AAGGTCAAAGGCAAAGGGGAACTCTGTACCTACTTCCTGAACACAGACCTGACGCGGACCGGATCTC
CC
TCAGCATCCTAG


Translation (1077 aa):
MARLFSPRPPPSEDLFYETYYSLSQQYPLLILLLVIVLCALVALPAVAWASGRELTSDPSFLTTVLCALG
G
FSLLLGLASREQQLQRWTRPLSGLIWVALLALGYGFLFTGGVVSAWDQ
VSFFLFIIFTVYAMLPLGMRD
A
AAAGVISSLSHLLVLGLYLGWQPESQRALLPQ
LAANAVLFLCGNVVGAYHKALMERALRATFREALSSL
H
SRRRLDTEKKHQ
EHLLLSILPAYLAREMKAEIMARLQAGQRSRPENTNNFHSLYVKRHQGVSVLYADIV
G
FTRLASECSPKELVLMLNELFGKFDQIAK
EHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCR
A
I
RKLRVATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
A
YAVERADTEHRDPYLRELGEPTYLVIDPR
AEEEDEKGTAKGLLSSLEGHTMRPSLLMTRYLESWGAAKP
F
AHLSHLDSPVSTSTPLP
EKAFSPQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSKDFNLL
T
LYFREKEMEKQ
YRLSALPAFKYYAACTFLVFLSNFTIQMLVTTRPPALIITYSITFLLFFLLLFVCFSE
H
LT
KCVQKGPKMLHWLPALSVLVATRPGFRVALGTATILLVFTMAIASLLFLPVSSDCLFLASNVSSVTF
N
ASWEMPGSLPLISIPLISIP
YSMHCCVLGFLSCSLFLHMSFELKLLLLLLWLVASCSLFLHSHAWLSDC
L
IARLYQSPSDS
RPGVLKEPKLMGAIYFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLT
R
LLLENVLPAHVAPQFIGQNRRNE
DLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIAD
F
DE
LLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDTQQDSERSCSHLGTMVEFAVALGSKLGVINKHSF
N
NFRLRV
GLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETARALQSLGYTCYSRGS
I
KVKGKGELCTYFLNTDLTRTGSPSAS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser