NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49323.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49323.1 Public Mus musculus 13 Vcan 16 104 75 CCDS HistoryNCBI Gene:13003Re-query CCDS DB by CCDS ID:49323.1Re-query CCDS DB by GeneID:13003See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 49323.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000159910 ENSMUSP00000125446 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000159910Link to Ensembl Protein Viewer:ENSMUSP00000125446Re-query CCDS DB by Nucleotide ID:ENSMUST00000159910Re-query CCDS DB by Protein ID:ENSMUSP00000125446
Original member Current member EBI,WTSI OTTMUST00000084376 OTTMUSP00000045464 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000084376Link to Vega Protein Viewer:OTTMUSP00000045464Re-query CCDS DB by Nucleotide ID:OTTMUST00000084376Re-query CCDS DB by Protein ID:OTTMUSP00000045464
Original member Current member NCBI NM_019389.2 NP_062262.2 Accepted alive Link to Nucleotide Sequence:NM_019389.2Link to Protein Sequence:NP_062262.2Re-query CCDS DB by Nucleotide ID:NM_019389Re-query CCDS DB by Protein ID:NP_062262Link to BLink:NP_062262.2

Chromosomal Locations for CCDS 49323.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 89657231 89657358 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 89657503 89657685 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 89661917 89662061 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 89678075 89678157 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 89679800 89679958 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 89684400 89684513 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 89685079 89685192 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 89688285 89693501 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 89712205 89712498 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 89721567 89721694 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 89721772 89721946 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 89725289 89725663 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 89731459 89731528 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (7185 nt):
ATGTTGATAAATATGAAAGGCATCTTATGGATGTGCTCAACCTTATTACTAACCCATGCACTACATCAAG
CC
AAAATGGAAACCAGCCCACCTGTTAAAGGCTCTCTGTCTGGAAAAGTGGTCCTACCTTGTCATTTTTC
A
ACCTTACCTACCTTACCACCCAATTACAACACGAGTGAATTTCTCAGAATCAAATGGTCTAAGATGGAA
GTG
GACAAAAATGGAAAAGATATAAAGGAGACGACTGTCTTGGTGGCCCAGAACGGAAATATCAAGATTG
GT
CAGGACTACAAGGGGCGAGTGTCCGTGCCTACACATCCCGATGATGTAGGTGATGCTTCCCTCACCAT
G
GTCAAACTCCGGGCTAGTGATGCAGGCGTCTACCGATGTGATGTCATGTATGGGATTGAAGACACTCAG
GAC
ACCATGTCACTGGCTGTGGATGGTGTTGTGTTTCACTACAGGGCAGCCACCAGCAGGTACACTCTGA
AC
TTTGCCGCTGCTCAACAGGCTTGTTTGGATATCGGGGCGGTCATAGCAAGCCCAGAGCAGCTGTTTGC
C
GCCTATGAGGATGGATTTGAGCAGTGTGATGCAGGATGGCTGTCTGATCAAACTGTCAGATATCCCATA
CGG
GCTCCCCGAGAGGGCTGTTACGGAGACATGATGGGGAAGGAAGGGGTTCGGACCTATGGATTCCGCT
CT
CCCCAGGAAACCTATGATGTGTATTGTTATGTGGATCATCTGGATGGCGATGTGTTCCACATCACTGC
T
CCCAGTAAGTTCACCTTCGAGGAGGCCGAAGCAGAGTGTACAAGCAGGGATGCGAGGCTGGCGACTGTT
GGA
GAACTTCAGGCAGCTTGGAGAAATGGCTTTGACCAATGCGATTACGGCTGGCTGTCGGATGCCAGCG
TG
CGGCACCCTGTGACTGTGGCCAGGGCCCAGTGTGGAGGAGGTCTACTTGGGGTGAGAACCCTGTATCG
T
TTTGAGAACCAGACATGCTTCCCTCTCCCTGATAGCAGATTTGATGCCTACTGCTTTAAACGTCGATTG
AGT
GATATGATTGTAAGTGGTCATCCAATAGATTCAGAATCTAAAGAAGAGGAACCTTGCAGTGAAGAAA
CA
GATCCACTGCATGATCTGTTTGCTGAAATTTTACCCGAGTTACCAGACTCATTTGAAATAGACATATA
T
CACAGTGAGGAAGATGAAGACGGAGAGGAGGACTGTGTAAATGCAACGGATGTAACAACTACTCCGTCA
GTG
CAGTATATCAATGGGAAGCAGCTCGTTACCACAGTGCCTAAGGACCCGGAAGCTGCAGAAGCTAGGC
GT
GGCCAGTACGAAAGTGTTGCACCTTCTCAGAATTTCCCAGATAGTTCTGCAACTGACACCCATCAGTT
T
ATACTAGCAGAAACAGAATCGTCAACTACCATGCAATTTAAGAAATCTAAAGAAGGCACGGAATTGTTA
GAA
ATCACATGGAAACCCGAGACCTACCCTGAAACACCAGACCATGTTTCAAGTGGTGAGCCTGATGTTT
TC
CCTACTCTCTCATCCCATGATGGTAAAACCACCAGATGGTCAGAGTCCATCACAGAGAGCAGTCCAAA
C
CTTGAAAATCCAGTGCACAAACAACCTAAGCCTGTCCCTCTGTTTCCTGAAGAGTCTTCAGGAGAGGGT
GCC
ATTGAACAAGCATCCCAGGAAACAATCTTATCTAGGGCTACAGAAGTAGCACTTGGTAAAGAGACAG
AC
CAAAGTCCTACCTTATCTACCTCTAGCATACTTTCAAGTTCTGTGTCAGTAAATGTCTTGGAGGAAGA
A
CCACTTACTCTAACAGGAATCTCACAGACTGATGAATCCATGTCTACTATAGAAAGCTGGGTAGAGATA
ACA
CCTAGCCAAACTGTAAAGTTCTCGGAGAGTTCTTCAGCTCCTATCATTGAAGGGTCTGGGGAAGTAG
AA
GAAAATAAAAATAAAATCTTTAACATGGTAACTGATTTACCACAGAGAGATCCTACAGATACACTCAG
C
CCTTTGGATATGAGCAAGATAATGATCACAAACCATCACATTTATATTCCTGCAACCACCGCTCCTTTG
GAT
TCAAAACTACCTTCTCCAGATGCAAGGCCTACACAGTTTGGAATTCAAACAGCCACCTCTGAGTGGG
TT
TCCGATAAGTCTTTTGAAGGAAGAAAAAGAGAAGAAGATGAAGAGGGAGCTGTGAATGCAGCCCACCA
A
GGAGAAGTTCGAGCAGCAACAGAGAGGTCAGATCACTTACTTTTAACACCAGAATTAGAAAGTTCAAAT
GTA
GATGCATCTAGTGATTTGGCTACCTGGGAAGGTTTTATTCTAGAGACAACACCCACAGAGTCTGAAA
AG
GAAATGGCAAATTCAACTCCTGTTTTTAGAGAAACAATTGGTGTAGCCAATGTGGAGGCACAGCCCTT
T
GAGCATAGCAGTAGTAGTCATCCCAGGGTTCAGGAAGAGCTGACCACTCTCTCAGGAAATCCCCCCTCT
CTT
TTTACGGACCTGGGCTCAGGAGATGCTAGTACTGGTATGGAACTCATCACTGCTTCTTTATTTACAT
TA
GATTTAGAGTCTGAAACCAAAGTCAAAAAGGAATTACCCAGTACTCCGTCTCCCAGTGTGGAGATATC
A
TCCTCTTTTGAGCCAACAGGATTAACCCCGAGTACTGTACTAGACATAGAAATTGCTGGAGTTATGAGC
CAG
ACATCGCAGAAGACACTGATTTCTGAAATATCAGGAAAGCCAACTTCCCAGTCAGGAGTAAGGGATT
TG
TATACAGGCTTTCCAATGGGAGAAGATTTTAGTGGTGACTTCAGTGAATATCCAACAGTGTCTTATCC
A
ACGATGAAAGAGGAAACAGTTGGGATGGGAGGTTCTGACGATGAACGAGTTAGGGATACACAGACTTCA
TCA
TCTATACCGACTACCTCAGACAACATCTACCCCGTGCCTGACTCAAAAGGACCTGACAGTACTGTGG
CC
AGCACCACAGCCTTCCCCTGGGAAGAGGTCATGTCCTCAGCTGAGGGGTCAGGTGAGCAATTAGCCTC
A
GTCAGGAGCTCTGTTGGTCCAGTGCTTCCACTAGCTGTGGACATTTTTTCTGGAACAGAGTCTCCATAT
TTT
GATGAAGAGTTTGAAGAAGTGGCTGCAGTGACAGAAGCAAATGAAAGACCCACTGTTTTGCCAACAG
CA
GCAAGTGGAAATACTGTAGATCTTACAGAAAATGGGTACATAGAGGTAAATAGCACGATGTCACTGGA
C
TTTCCCCAGACAATGGAGCCATCCAAATTGTGGTCTAAACCAGAAGTCAATCTTGATAAACAAGAGATT
GGA
AGAGAAACAGTGACAAAGGAAAAAGCTCAGGGACAAAAGACTTTTGAATCGCTCCACAGTTCTTTTG
CA
CCAGAACAAACCATTTTGGAAACCCAATCACTTATTGAAACTGAATTCCAAACTTCCGATTACTCTAT
G
TTAACAACACTGAAAACGTACATTACTAATAAGGAAGTGGAGGAGGAAGGTATGTCCATAGCGCATATG
TCT
ACTCCAGGTCCAGGGATCAAAGACTTGGAATCATATACTACCCATCCCGAAGCTCCTGGAAAGTCAC
AC
TCTTTCTCAGCTACTGCTTTAGTGACTGAATCTGGAGCAGCTAGAAGTGTACTCATGGATTCCTCAAC
T
CAAGAGGAAGAAAGCATAAAACTCTTCCAAAAGGGTGTGAAACTAACAAATAAAGAGTCAAATGCTGAT
CTC
TCATTCTCTGGACTGGGATCAGGAGAGGCTTTGCCTCCTCTACCTACAACATCAGTGAATTTGACTG
AC
ATGAAGCAGATCATTAGCACATTGTATGCTGAGACATCTCACATGGAAAGCTTAGGAACAAGCATCTT
A
GGTGATAAAATGGAAGACCATGAAAGAATGGAAGATGTGTCCAATGAAGTTAGAATGCTCATTTCCAAA
ACA
GGCAGCATCTCTCAAGACAGCACAGAGGCACTCGACACAACTTTGAGTCATACCGGAACAGAAGAAC
CT
ACAACTTCAACTCTTCCTTTCGTGAAGCTCATGGACTTGGAACGTTCTCCAAAGCAGACCCTCAGGTG
G
GAAGAGGAAACCCAGACCCATAGACCACAAACTATGAGTGGACTGATCTCTAATGAAAATTCTTCAGCA
TCA
GAAGCTGAAGAAGCAGCAACTTCCCCCACTGCTTTTCTGCCTCAAACTTACAGTGTTGAAATGACCA
AA
CACTTTGCTCCATCAGAGTCACAACCATCCGACTTGTTTAATGTAAACTCTGGAGAGGGATCTGGAGA
A
GTGGATACTCTTGACTTAGTGTACACTTCTGGAACTACTCAGGCAAGCAGTCAAGGAGACAGCATGCTT
GCT
TCTCATGGATTTCTGGAAAAACATCCAGAGGTGTCAAAGACTGAGGCTGGAGCTACTGATGTATCTC
CA
ACAGCCTCAGCAATGTTCCTGCATCACTCAGAGTACAAGAGTTCTCTGTATCCAACCAGCACACTGCC
A
AGCACAGAGCCATATAAAAGTCCCTCAGAAGGTATTGAAGATGGTTTGCAAGACAATATCCAATTTGAA
GGT
TCTACCTTGAAACCTAGCAGAAGAAAAACCACTGAAAGCATTATTATAGATCTAGACAAAGAGGATA
GT
AAGGACCTAGGATTGACAATTACTGAGAGTGCTATTGTTGAAATTCTCCCTGAGCTGACATCAGATAA
A
AATATTATTATAGACATTGATCACACTAAACCTGTATATGAGTACATCCCTGGAATACAAACAGACCTA
GAT
CCAGAGATAAAATTGGAATCACATGGCAGTAGTGAAGAAAGCCTTCAAGTTCAAGAGAAGTATGAGG
GA
GCTGTTACCCTTTCTCCAACTGAGGAATCATTTGAAGGCTCTGGTGATGCGCTTCTTGCTGGCTATAC
T
CAAGCAATATACAATGAGTCTGTGACTCCCAACGATGGAAAGCAGGCAGAGGACATAAGCTTTAGTTTT
GCC
ACTGGGATCCCAGTTTCTAGCACAGAGACAGAATTACACACTTTCTTCCCCACAGCGTCAACCCTGC
AC
ATTCCTAGTAAACTAACCACAGCTAGTCCGGAGATTGATAAACCCAACATTGAAGCAATATCTCTGGA
T
GATATATTTGAATCAAGCACCTTGTCTGATGGCCAAGCTATTGCAGACCAGAGTGAAGTAATATCAACA
TTA
GGGCATTTGGAAAAAACACAGGAAGAATATGAAGAAAAGAAATATGGAGGTCCTTCATTTCAGCCAG
AA
TTCTTTTCAGGAGTGGGGGAAGTATTGACAGATCCCCCTGCTTATGTAAGTATTGGTAGTACATACCT
T
ATAGCTCAGACTTTAACAGAATTACCCAATGTGGTAAGACCATCTGACTCCACACATTACACTGAAGCA
ACA
CCTGAAGTTTCCTCTCTGGCAGAGCTCTCTCCACAGATACCATCTTCTCCCTTCCCTGTCTACGTAG
AC
AATGGAGTCTCTAAATTCCCAGAGGTTCCCCATACAAGTGCTCAGCCAGTTTCTACTGTCACCTCATC
A
CAAAAGTCTATAGAGAGTCCTTTTAAGGAAGTCCATGCTAATATTGAAGAAACCATCAAGCCATTGGGT
GGA
AATGTCCACAGAACAGAGCCTCCATCCATGTCTCGTGACCCTGCTTTAGATGTTTCAGAAGATGAAA
GT
AAGCATAAGTTACTAGAAGAACTGGAAACGTCTCCCACCAAACCTGAGACTTCCCAAGACTTCCCAAA
C
AAAGCAAAGGATCACATTCCAGGAGAAACAGTTGGGATGCTTGCTGGTATCAGAACAACAGAGAGCGAA
CCT
GTCATTACTGCAGACGACATGGAGCTAGGAGGTGCCACACAGCAGCCACATTCTGCTTCTGCAGCTT
TC
AGAGTTGAGACAGGTATGGTACCTCAGCCCATCCAACAGGAGCCTGAGAGGCCAACCTTTCCTTCCTT
G
GAAATTAACCATGAAACACACACATCATTATTTGGAGAATCTATACTGGCAACATCTGAAAAACAAGTG
TCT
CAAAAAATTCTTGATAATAGTAACCAGGCAACAGTCAGTAGTACTCTGGATCTACATACTGCACATG
CA
TTATCACCATTTTCCATTCTGGACAATTCTAATGAAACTGCTTTCCTGATTGGCATTAGTGAAGAGTC
C
GTGGAAGGCACAGCAGTTTACCTACCAGGACCTGATCTCTGCAAAACAAACCCATGCCTCAACGGAGGC
ACC
TGTTATCCTACCGAGACTTCCTATGTGTGCACCTGTGCACCTGGATACAGCGGAGACCAGTGTGAAC
TT
GATTTTGATGAATGTCACTCTAACCCTTGTCGGAATGGTGCCACCTGTGTGGATGGTTTTAATACATT
T
AGATGTCTCTGTCTCCCAAGTTATGTTGGTGCACTCTGTGAACAAGACACTGAGACATGTGACTATGGC
TGG
CACAAATTCCAAGGACAGTGCTACAAGTACTTTGCTCATCGACGCACATGGGATGCTGCTGAAAGGG
AG
TGTCGCCTGCAGGGTGCCCACCTCACAAGCATCCTTTCTCATGAGGAACAAATGTTTGTGAATCGTGT
G
GGCCATGATTACCAGTGGATCGGCCTCAATGACAAGATGTTTGAACATGACTTCCGCTGGACTGACGGC
AGT
GCACTGCAATATGAGAACTGGAGACCCAACCAGCCAGACAGTTTCTTTTCTGCAGGAGAAGACTGCG
TT
GTGATCATTTGGCATGAAAATGGTCAGTGGAATGACGTCCCCTGCAATTACCACCTCACCTACACTTG
C
AAGAAGGGAACAGTTGCTTGCGGCCAACCCCCTGTTGTAGAAAATGCCAAGACCTTTGGAAAGATGAAA
CCA
CGCTATGAAATCAACTCCTTGATTAGATATCACTGCAAAGATGGTTTCATTCAGCGACACCTTCCAA
CT
ATCCGGTGCCTAGGAAACGGGAGATGGGCAATGCCTAAAATAACCTGCATGAACCCATCTGCATACCA
A
AGGACTTATTCTAAGAAATACTTAAAAAATTCCTCATCCGCAAAGGACAATTCTATAAATACATCAAAA
CAT
GAGCATCGCTGGAGCCGGAGGCGGCAGGAAACCAGGCGCTGA


Translation (2394 aa):
MLINMKGILWMCSTLLLTHALHQAKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKME
V
DKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAGVYRCDVMYGIEDTQ
D
TMSLAVD
GVVFHYRAATSRYTLNFAAAQQACLDIGAVIASPEQLFAAYEDGFEQCDAGWLSDQTVRYPI
R
APREGCYGDMMGKEGVRTYGFRSPQETYDVYCYVDHLD
GDVFHITAPSKFTFEEAEAECTSRDARLATV
G
ELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTCFPLPDSRFDAYCFK
RRL
S
DMIVSGHPIDSESKEEEPCSEETDPLHDLFAEILPELPDSFEIDIYHSEEDEDGEEDCVNATDVTTTPS
V
QYINGKQLVTTVPKDPEAAEARRGQYESVAPSQNFPDSSATDTHQFILAETESSTTMQFKKSKEGTELL
E
ITWKPETYPETPDHVSSGEPDVFPTLSSHDGKTTRWSESITESSPNLENPVHKQPKPVPLFPEESSGEG
A
IEQASQETILSRATEVALGKETDQSPTLSTSSILSSSVSVNVLEEEPLTLTGISQTDESMSTIESWVEI
T
PSQTVKFSESSSAPIIEGSGEVEENKNKIFNMVTDLPQRDPTDTLSPLDMSKIMITNHHIYIPATTAPL
D
SKLPSPDARPTQFGIQTATSEWVSDKSFEGRKREEDEEGAVNAAHQGEVRAATERSDHLLLTPELESSN
V
DASSDLATWEGFILETTPTESEKEMANSTPVFRETIGVANVEAQPFEHSSSSHPRVQEELTTLSGNPPS
L
FTDLGSGDASTGMELITASLFTLDLESETKVKKELPSTPSPSVEISSSFEPTGLTPSTVLDIEIAGVMS
Q
TSQKTLISEISGKPTSQSGVRDLYTGFPMGEDFSGDFSEYPTVSYPTMKEETVGMGGSDDERVRDTQTS
S
SIPTTSDNIYPVPDSKGPDSTVASTTAFPWEEVMSSAEGSGEQLASVRSSVGPVLPLAVDIFSGTESPY
F
DEEFEEVAAVTEANERPTVLPTAASGNTVDLTENGYIEVNSTMSLDFPQTMEPSKLWSKPEVNLDKQEI
G
RETVTKEKAQGQKTFESLHSSFAPEQTILETQSLIETEFQTSDYSMLTTLKTYITNKEVEEEGMSIAHM
S
TPGPGIKDLESYTTHPEAPGKSHSFSATALVTESGAARSVLMDSSTQEEESIKLFQKGVKLTNKESNAD
L
SFSGLGSGEALPPLPTTSVNLTDMKQIISTLYAETSHMESLGTSILGDKMEDHERMEDVSNEVRMLISK
T
GSISQDSTEALDTTLSHTGTEEPTTSTLPFVKLMDLERSPKQTLRWEEETQTHRPQTMSGLISNENSSA
S
EAEEAATSPTAFLPQTYSVEMTKHFAPSESQPSDLFNVNSGEGSGEVDTLDLVYTSGTTQASSQGDSML
A
SHGFLEKHPEVSKTEAGATDVSPTASAMFLHHSEYKSSLYPTSTLPSTEPYKSPSEGIEDGLQDNIQFE
G
STLKPSRRKTTESIIIDLDKEDSKDLGLTITESAIVEILPELTSDKNIIIDIDHTKPVYEYIPGIQTDL
D
PEIKLESHGSSEESLQVQEKYEGAVTLSPTEESFEGSGDALLAGYTQAIYNESVTPNDGKQAEDISFSF
A
TGIPVSSTETELHTFFPTASTLHIPSKLTTASPEIDKPNIEAISLDDIFESSTLSDGQAIADQSEVIST
L
GHLEKTQEEYEEKKYGGPSFQPEFFSGVGEVLTDPPAYVSIGSTYLIAQTLTELPNVVRPSDSTHYTEA
T
PEVSSLAELSPQIPSSPFPVYVDNGVSKFPEVPHTSAQPVSTVTSSQKSIESPFKEVHANIEETIKPLG
G
NVHRTEPPSMSRDPALDVSEDESKHKLLEELETSPTKPETSQDFPNKAKDHIPGETVGMLAGIRTTESE
P
VITADDMELGGATQQPHSASAAFRVETGMVPQPIQQEPERPTFPSLEINHETHTSLFGESILATSEKQV
S
QKILDNSNQATVSSTLDLHTAHALSPFSILDNSNETAFLIGISEESVEGTAVYLP
GPDLCKTNPCLNGG
T
CYPTETSYVCTCAPGYSGDQCEL
DFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYG
W
HKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVN
RVGHDYQWIGLNDKMFEHDFRWTDG
S
AL
QYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMK
P
RYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAMPKITCMN
PSAYQRTYSKKYLKNSSSAKDNSINTSK
H
EHRWSRRRQETRR




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser