NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23582.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23582.1 Public Mus musculus 9 Ccrl2 16 104 75 CCDS HistoryNCBI Gene:54199Re-query CCDS DB by CCDS ID:23582.1Re-query CCDS DB by GeneID:54199

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 23582.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000111888 ENSMUSP00000107519 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111888Link to Ensembl Protein Viewer:ENSMUSP00000107519Re-query CCDS DB by Nucleotide ID:ENSMUST00000111888Re-query CCDS DB by Protein ID:ENSMUSP00000107519
Original member Current member NCBI NM_017466.4 NP_059494.2 Accepted alive Link to Nucleotide Sequence:NM_017466.4Link to Protein Sequence:NP_059494.2Re-query CCDS DB by Nucleotide ID:NM_017466Re-query CCDS DB by Protein ID:NP_059494Link to BLink:NP_059494.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_059494.2 360 O35457 360 100% 0 0

Chromosomal Locations for CCDS 23582.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

Chromosome Start Stop Links
9 111055346 111056428 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1083 nt):
ATGGATAACTACACAGTGGCCCCGGACGATGAATATGATGTCCTAATCTTAGACGACTACCTGGACAACA
GT
GGGCCGGACCAAGTTCCGGCCCCCGAGTTCCTCTCCCCCCAGCAGGTGCTGCAGTTCTGCTGCGCGGT
G
TTTGCGGTGGGTCTCTTGGACAACGTGCTGGCGGTGTTTATCTTGGTGAAATACAAAGGACTCAAGAAT
CTG
GGGAACATCTACTTCCTAAACCTGGCACTTTCAAACCTGTGTTTCCTGCTTCCCCTGCCGTTCTGGG
CC
CATACTGCAGCACACGGGGAAAGCCCTGGCAATGGGACCTGTAAAGTTCTTGTCGGACTCCACTCCTC
G
GGCTTATACAGCGAGGTGTTTTCCAACATCCTCCTCCTTGTGCAAGGATACAGGGTGTTTTCCCAAGGG
CGA
CTGGCCTCCATCTTCACGACAGTGTCTTGTGGTATTGTTGCGTGCATCCTGGCATGGGCCATGGCTA
CT
GCGCTCTCTTTGCCCGAGTCTGTGTTTTATGAGCCTCGGATGGAAAGACAGAAACACAAGTGTGCCTT
T
GGCAAACCTCACTTCTTGCCAATCGAAGCGCCGCTCTGGAAGTACGTTCTGACGTCAAAAATGATCATC
TTG
GTACTTGCTTTTCCTCTGCTGGTTTTTATAATCTGCTGCAGGCAACTGAGGAGAAGGCAGAGCTTCA
GG
GAGAGACAGTACGACCTCCACAAGCCGGCTCTTGTCATAACGGGCGTGTTCCTTTTGATGTGGGCGCC
T
TACAACACTGTGCTTTTCCTGTCTGCTTTCCAGGAACACTTGTCCCTGCAGGATGAGAAGAGCAGCTAC
CAC
CTGGACGCAAGTGTTCAGGTCACACAGCTGGTAGCGACCACCCACTGCTGCGTCAACCCGCTGCTCT
AT
TTGCTTCTTGACCGGAAGGCCTTTATGAGATACCTTCGCAGCCTGTTCCCACGGTGCAATGATATCCC
C
TATCAAAGTAGTGGAGGCTATCAGCAAGCGCCTCCAAGGGAAGGTCATGGCAGGCCCATTGAACTGTAC
AGC
AATTTGCATCAAAGGCAGGATATAATATAA


Translation (360 aa):
MDNYTVAPDDEYDVLILDDYLDNSGPDQVPAPEFLSPQQVLQFCCAVFAVGLLDNVLAVFILVKYKGLKN
L
GNIYFLNLALSNLCFLLPLPFWAHTAAHGESPGNGTCKVLVGLHSSGLYSEVFSNILLLVQGYRVFSQG
R
LASIFTTVSCGIVACILAWAMATALSLPESVFYEPRMERQKHKCAFGKPHFLPIEAPLWKYVLTSKMII
L
VLAFPLLVFIICCRQLRRRQSFRERQYDLHKPALVITGVFLLMWAPYNTVLFLSAFQEHLSLQDEKSSY
H
LDASVQVTQLVATTHCCVNPLLYLLLDRKAFMRYLRSLFPRCNDIPYQSSGGYQQAPPREGHGRPIELY
S
NLHQRQDII




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser