NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36456.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36456.1 Public Mus musculus 12 Sstr1 16 104 75 CCDS HistoryNCBI Gene:20605Re-query CCDS DB by CCDS ID:36456.1Re-query CCDS DB by GeneID:20605See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 36456.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000044299 ENSMUSP00000037045 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000044299Link to Ensembl Protein Viewer:ENSMUSP00000037045Re-query CCDS DB by Nucleotide ID:ENSMUST00000044299Re-query CCDS DB by Protein ID:ENSMUSP00000037045
Original member Current member EBI,WTSI ENSMUST00000110671 ENSMUSP00000106299 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110671Link to Ensembl Protein Viewer:ENSMUSP00000106299Re-query CCDS DB by Nucleotide ID:ENSMUST00000110671Re-query CCDS DB by Protein ID:ENSMUSP00000106299
Original member Current member EBI,WTSI OTTMUST00000095213 OTTMUSP00000053112 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000095213Link to Vega Protein Viewer:OTTMUSP00000053112Re-query CCDS DB by Nucleotide ID:OTTMUST00000095213Re-query CCDS DB by Protein ID:OTTMUSP00000053112
Original member Current member NCBI NM_009216.3 NP_033242.1 Accepted alive Link to Nucleotide Sequence:NM_009216.3Link to Protein Sequence:NP_033242.1Re-query CCDS DB by Nucleotide ID:NM_009216Re-query CCDS DB by Protein ID:NP_033242Link to BLink:NP_033242.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033242.1 391 P30873 391 100% 0 0

Chromosomal Locations for CCDS 36456.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 58212593 58213768 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1176 nt):
ATGTTCCCCAATGGCACCGCCTCCTCTCCCTCCTCTTCTCCAAGCCCCAGCCCAGGCAGCTGCGGGGAAG
GA
GCCTGCAGCAGGGGTCCGGGGTCCGGCGCTGCGGACGGCATGGAAGAGCCTGGACGAAACGCTTCCCA
G
AATGGGACCTTAAGCGAGGGACAGGGTAGCGCCATTCTCATCTCTTTCATCTACTCCGTGGTATGCTTG
GTG
GGACTGTGTGGGAACTCTATGGTCATCTATGTGATCCTGCGCTACGCCAAGATGAAGACCGCTACCA
AC
ATCTACATTCTAAACCTGGCTATTGCTGATGAGCTGCTCATGCTCAGCGTGCCCTTTCTGGTCACTTC
C
ACGCTGTTGCGCCACTGGCCCTTCGGCGCGCTACTTTGCCGCCTGGTGCTCAGCGTGGATGCGGTCAAC
ATG
TTCACCAGCATCTACTGTCTGACTGTGCTTAGTGTGGACCGCTATGTGGCTGTGGTGCACCCGATCA
AG
GCAGCGCGCTACCGTCGGCCCACTGTGGCCAAAGTAGTGAACCTGGGCGTGTGGGTCCTGTCATTACT
G
GTTATCTTGCCCATCGTGGTCTTCTCACGCACCGCAGCCAACAGCGATGGCACGGTAGCCTGCAACATG
CTC
ATGCCCGAGCCCGCCCAGCGCTGGTTGGTGGGCTTCGTCTTATACACATTTCTCATGGGCTTCCTGC
TG
CCTGTCGGGGCCATTTGCCTGTGTTATGTGCTCATCATTGCCAAGATGCGCATGGTGGCCCTCAAGGC
T
GGCTGGCAGCAGCGCAAGCGCTCAGAGCGCAAGATCACTCTAATGGTGATGATGGTGGTGATGGTTTTT
GTC
ATCTGCTGGATGCCTTTCTACGTGGTACAGCTGGTCAACGTGTTCGCCGAGCAAGACGACGCCACCG
TG
AGCCAGTTGTCTGTCATCCTGGGCTATGCCAACAGCTGTGCCAACCCCATCCTCTACGGCTTCCTGTC
G
GACAACTTCAAGCGCTCTTTCCAGCGCATCCTGTGCCTCAGCTGGATGGATAACGCTGCGGAGGAACCA
GTC
GACTACTATGCCACTGCCCTGAAGAGTCGAGCCTACAGCGTGGAGGACTTCCAGCCCGAGAATCTGG
AG
TCTGGAGGCGTTTTCCGTAATGGCACCTGCGCTTCCAGGATCAGCACGCTTTGA


Translation (391 aa):
MFPNGTASSPSSSPSPSPGSCGEGACSRGPGSGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCL
V
GLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDAVN
M
FTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNM
L
MPEPAQRWLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVF
V
ICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEP
V
DYYATALKSRAYSVEDFQPENLESGGVFRNGTCASRISTL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser