NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36927.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36927.1 Public Mus musculus 14 Myh6 16 104 75 CCDS HistoryNCBI Gene:17888Re-query CCDS DB by CCDS ID:36927.1Re-query CCDS DB by GeneID:17888See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 36927.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000081857 ENSMUSP00000080538 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000081857Link to Ensembl Protein Viewer:ENSMUSP00000080538Re-query CCDS DB by Nucleotide ID:ENSMUST00000081857Re-query CCDS DB by Protein ID:ENSMUSP00000080538
Original member Current member NCBI NM_001164171.1 NP_001157643.1 Accepted alive Link to Nucleotide Sequence:NM_001164171.1Link to Protein Sequence:NP_001157643.1Re-query CCDS DB by Nucleotide ID:NM_001164171Re-query CCDS DB by Protein ID:NP_001157643Link to BLink:NP_001157643.1
Original member Current member NCBI NM_010856.4 NP_034986.1 Accepted alive Link to Nucleotide Sequence:NM_010856.4Link to Protein Sequence:NP_034986.1Re-query CCDS DB by Nucleotide ID:NM_010856Re-query CCDS DB by Protein ID:NP_034986Link to BLink:NP_034986.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001157643.1 1938 Q02566 1938 100% 0 0
NP_034986.1 1938 Q02566 1938 100% 0 0

Chromosomal Locations for CCDS 36927.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 54941981 54942001 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54942353 54942487 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54943148 54943243 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54944278 54944553 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54944661 54944786 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54946313 54946516 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54946914 54947222 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54948081 54948205 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54948292 54948457 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54948612 54948795 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54949338 54949534 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54949845 54949963 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54950052 54950178 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54950264 54950653 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54952246 54952336 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54952574 54952719 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54952954 54953130 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54953289 54953531 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54953698 54953953 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54956502 54956638 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54956879 54957002 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54957143 54957260 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54957347 54957434 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54957760 54957830 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54958450 54958759 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54959801 54959971 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54960270 54960538 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54960945 54961083 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54961167 54961270 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54961729 54961827 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54962054 54962117 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54962686 54962778 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54963021 54963132 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54963380 54963407 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54963502 54963658 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54963896 54964039 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54965260 54965460 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5817 nt):
ATGACGGACGCCCAGATGGCTGACTTCGGGGCAGCAGCCCAGTACCTCCGAAAGTCAGAGAAGGAACGCC
TA
GAGGCCCAGACCCGGCCCTTTGACATCCGCACGGAGTGCTTCGTGCCTGATGACAAGGAGGAGTATGT
T
AAGGCCAAGGTCGTGTCCCGGGAAGGGGGCAAAGTCACTGCGGAAACTGAAAACGGAAAGACGGTGACC
ATA
AAGGAGGACCAGGTGATGCAGCAGAACCCACCCAAGTTCGACAAGATCGAGGACATGGCCATGCTGA
CC
TTCCTGCACGAGCCGGCTGTGCTGTACAACCTCAAGGAGCGCTACGCGGCCTGGATGATCTATACCTA
C
TCAGGCCTCTTCTGCGTCACCGTCAACCCCTATAAGTGGCTGCCTGTGTACAATGCGGAAGTGGTGGCC
GCC
TACCGGGGCAAGAAGAGGAGCGAGGCCCCTCCTCACATCTTCTCCATCTCTGACAACGCCTATCAGT
AC
ATGCTGACAGATCGGGAGAATCAGTCCATCCTCATCACCGGAGAATCCGGAGCGGGGAAGACTGTGAA
C
ACAAAACGTGTCATCCAGTACTTTGCCAGCATTGCAGCCATAGGGGACCGTAGCAAGAAGGAAAATCCT
AAT
GCAAACAAGGGCACCCTGGAGGACCAGATTATCCAGGCTAACCCCGCTCTGGAGGCCTTCGGCAACG
CC
AAGACTGTCCGGAATGACAACTCCTCCCGCTTTGGGAAATTCATCAGGATCCACTTTGGAGCTACTGG
A
AAGCTGGCTTCTGCAGACATAGAGACCTACCTTCTGGAGAAGTCCCGGGTGATCTTCCAGCTAAAGGCT
GAG
AGGAACTACCACATCTTCTACCAGATCCTGTCCAACAAGAAGCCGGAGCTGCTGGACATGCTGCTGG
TC
ACCAACAACCCATACGACTACGCCTTCGTCTCTCAGGGAGAGGTGTCCGTGGCCTCCATTGATGACTC
T
GAGGAGCTCTTGGCCACTGATAGTGCCTTTGATGTGCTGAGCTTCACGGCAGAGGAGAAGGCTGGTGTC
TAC
AAGCTGACAGGGGCCATCATGCACTACGGAAACATGAAGTTCAAGCAGAAGCAGCGGGAGGAGCAGG
CG
GAGCCTGATGGCACAGAAGATGCTGACAAATCTGCCTACCTTATGGGGCTGAACTCAGCTGACCTGCT
C
AAGGGCCTGTGTCACCCTCGGGTGAAGGTGGGGAACGAGTATGTCACCAAGGGGCAGAGTGTACAGCAA
GTG
TACTATTCCATCGGGGCACTGGCCAAGTCAGTGTACGAGAAGATGTTCAACTGGATGGTGACACGCA
TC
AACGCAACCCTGGAGACCAAGCAGCCGCGCCAGTACTTCATAGGTGTCCTGGACATTGCCGGCTTTGA
G
ATCTTCGATTTCAACAGCTTTGAGCAGCTGTGCATCAACTTCACCAATGAGAAGCTGCAGCAGTTCTTC
AAC
CACCACATGTTCGTGCTGGAGCAGGAGGAGTACAAGAAGGAGGGCATTGAGTGGGAGTTTATCGACT
TC
GGCATGGACCTGCAGGCCTGCATCGACCTCATCGAGAAGCCCATGGGCATCATGTCCATCCTCGAGGA
G
GAGTGCATGTTCCCCAAGGCCTCAGACATGACCTTCAAGGCCAAGCTGTATGACAACCACCTGGGCAAA
TCC
AACAACTTCCAGAAGCCTCGCAATGTCAAGGGGAAGCAGGAAGCCCACTTCTCCTTGGTCCACTATG
CT
GGCACCGTGGACTACAACATTATGGGCTGGCTGGAAAAGAACAAGGACCCACTCAATGAGACGGTGGT
G
GGTTTGTACCAGAAGTCCTCCCTCAAGCTCATGGCTACACTCTTCTCTACCTATGCTTCTGCTGATACC
G
GT
GACAGTGGTAAAGGCAAAGGAGGCAAGAAGAAAGGCTCATCCTTCCAAACAGTGTCTGCTCTCCACC
GG
GAAAATCTGAACAAGCTGATGACAAACCTGAAGACCACCCACCCTCACTTTGTGCGCTGCATCATTCC
C
AACGAGCGAAAGGCTCCAGGGGTGATGGACAACCCCCTGGTCATGCACCAGCTGCGATGCAATGGCGTG
CTG
GAGGGTATCCGCATCTGCAGGAAGGGCTTCCCCAACCGCATTCTCTATGGGGACTTCCGGCAGAGGT
AT
CGCATCCTGAACCCAGCAGCCATCCCTGAGGGGCAATTCATTGATAGCAGGAAAGGGGCTGAGAAACT
G
CTGGGCTCCCTGGACATTGACCACAACCAATACAAGTTTGGCCACACCAAGGTGTTCTTCAAGGCGGGC
CTG
CTGGGGCTGCTCGAGGAGATGCGAGATGAGAGGCTGAGCCGTATCATCACCAGAATCCAGGCCCAGG
CC
CGAGGGCAGCTCATGCGCATTGAGTTCAAGAAGATAGTGGAACGCAGGGATGCCCTGCTGGTTATCCA
G
TGGAACATTCGGGCCTTCATGGGGGTCAAGAATTGGCCATGGATGAAGCTCTACTTCAAGATCAAACCG
CTG
CTGAAGAGCGCAGAGACGGAGAAGGAGATGGCCAACATGAAGGAGGAGTTTGGGCGAGTCAAAGATG
CA
CTGGAGAAGTCTGAGGCTCGCCGCAAGGAGCTGGAGGAGAAGATGGTGTCCCTGCTGCAGGAGAAGAA
T
GACCTACAGCTCCAAGTGCAGGCGGAACAAGACAACCTCAATGATGCAGAGGAGCGCTGTGACCAGCTG
ATC
AAGAACAAGATCCAGCTGGAGGCCAAGGTGAAGGAGATGACCGAGAGGCTGGAGGACGAGGAGGAGA
TG
AACGCCGAGCTCACTGCCAAGAAGCGCAAGCTGGAAGATGAGTGCTCAGAGCTCAAGAAGGATATTGA
T
GACCTGGAGCTGACGCTGGCCAAGGTGGAAAAGGAAAAGCATGCAACAGAGAACAAGGTTAAAAACCTA
ACA
GAGGAGATGGCTGGGCTGGATGAAATCATTGCCAAGCTGACCAAAGAGAAGAAAGCTCTGCAAGAAG
CC
CACCAGCAAGCCCTCGATGACCTGCAGGCTGAAGAAGACAAGGTCAACACGCTGACCAAGTCCAAAGT
C
AAGCTGGAGCAGCAGGTGGATGATCTGGAGGGATCCCTGGAGCAGGAGAAGAAAGTGCGCATGGACCTA
GAG
CGAGCCAAGCGGAAGCTGGAGGGAGACCTGAAGCTGACCCAGGAGAGCATCATGGACCTGGAGAATG
AC
AAGCTTCAGCTGGAAGAAAAGCTCAAGAAGAAAGAGTTCGACATCAGTCAGCAGAACAGTAAAATTGA
G
GACGAGCAGGCCCTGGCTCTTCAGCTGCAGAAGAAACTGAAGGAAAACCAGGCACGCATCGAGGAGCTG
GAG
GAGGAGCTGGAGGCAGAGCGCACAGCCCGGGCTAAGGTGGAGAAGCTGCGCTCTGACCTGTCCCGGG
AG
CTGGAGGAGATCAGTGAGAGGCTGGAGGAGGCAGGCGGGGCCACATCCGTGCAGATAGAGATGAATAA
G
AAGCGCGAGGCCGAGTTCCAGAAGATGCGGCGGGACCTGGAGGAGGCCACGCTGCAGCACGAGGCCACG
GCG
GCGGCCCTGCGCAAGAAGCATGCTGACAGCGTGGCGGAGCTGGGCGAGCAGATCGACAACCTCCAGC
GG
GTGAAGCAGAAGCTGGAGAAAGAGAAGAGCGAGTTCAAGCTGGAGCTGGATGACGTCACCTCCAACAT
G
GAGCAGATCATCAAGGCCAAGGCCAACCTGGAGAAAGTGTCCCGGACACTGGAGGACCAGGCCAATGAG
TAC
CGCGTGAAGCTGGAAGAAGCCCAGCGCTCCCTCAATGACTTCACCACACAGCGAGCCAAGCTGCAGA
CA
GAGAACGGGGAGTTGGCTAGGCAACTGGAAGAAAAGGAGGCATTGATTTCCCAGCTGACCCGAGGCAA
G
CTCTCCTACACCCAGCAGATGGAGGACCTCAAGAGGCAACTGGAGGAGGAAGGCAAGGCCAAGAACGCC
CTG
GCCCACGCACTGCAATCATCCCGGCATGACTGTGACCTGCTGAGGGAACAGTATGAAGAAGAAATGG
AG
GCCAAGGCTGAGCTACAGCGTGTCCTGTCCAAGGCCAACTCAGAGGTGGCCCAGTGGAGGACCAAGTA
T
GAGACGGATGCCATACAGAGGACGGAGGAGCTGGAGGAAGCCAAGAAGAAGCTGGCTCAGAGGCTGCAG
GAT
GCAGAGGAGGCAGTGGAGGCCGTCAACGCCAAGTGTTCCTCCCTGGAGAAGACCAAGCACAGGCTGC
AG
AATGAGATCGAGGACCTGATGGTGGACGTGGAGCGCTCCAATGCCGCCGCCGCAGCCCTGGACAAGAA
G
CAGAGGAACTTTGACAAGATCCTGGCTGAGTGGAAGCAGAAGTATGAGGAGTCGCAGTCAGAGCTGGAG
TCT
TCCCAGAAGGAGGCGCGCTCCCTGAGCACAGAGCTCTTCAAGCTCAAGAACGCCTATGAGGAGTCTC
TG
GAGCACCTGGAGACCTTCAAGCGGGAGAACAAGAACCTCCAGGAGGAGATCTCAGACCTGACTGAACA
G
CTGGGAGAAGGGGGGAAAAACGTGCACGAGCTGGAGAAGATCCGCAAACAGCTGGAGGTGGAGAAGCTG
GAG
CTGCAGTCAGCCCTGGAGGAGGCTGAGGCCTCCCTGGAGCACGAGGAGGGCAAGATCCTCCGTGCCC
AG
CTGGAGTTCAACCAGATCAAGGCAGAGATCGAAAGGAAGCTGGCAGAGAAGGATGAGGAGATGGAGCA
G
GCCAAGCGCAACCACCTGCGGATGGTGGACTCCCTGCAGACCTCCCTGGATGCGGAGACACGCAGCCGC
AAT
GAGGCCCTGCGGGTGAAGAAGAAGATGGAGGGCGACCTCAACGAGATGGAGATCCAGCTCAGCCAGG
CC
AATAGAATAGCCTCAGAGGCACAGAAACACCTGAAGAATTCTCAAGCTCACTTGAAGGACACCCAGCT
C
CAGCTGGATGATGCTGTCCATGCCAATGACGACCTGAAGGAGAACATCGCCATCGTGGAACGGCGCAAC
AAC
CTGCTGCAGGCGGAGCTGGAGGAGCTGCGGGCTGTGGTGGAGCAGACGGAGCGGTCTCGGAAGCTGG
CA
GAGCAGGAGCTGATTGAGACCAGCGAGCGGGTGCAGCTGCTGCACTCGCAGAACACCAGCCTCATCAA
C
CAGAAGAAGAAGATGGAGTCAGACCTGACCCAACTCCAGACAGAAGTAGAGGAGGCAGTGCAGGAGTGT
AGG
AACGCAGAGGAGAAGGCCAAGAAGGCCATCACAGATGCCGCAATGATGGCTGAGGAGCTGAAGAAGG
AG
CAGGACACCAGCGCCCACCTGGAGCGCATGAAGAAGAACATGGAGCAGACCATCAAGGACTTGCAGCA
C
CGTCTGGACGAGGCAGAGCAGATCGCCCTCAAGGGCGGCAAGAAGCAGCTGCAGAAGCTGGAGGCCCGG
GTC
CGGGAGCTGGAGAATGAGCTGGAGGCTGAGCAGAAGCGCAATGCAGAGTCGGTGAAGGGCATGAGGA
AG
AGCGAGCGGCGCATCAAGGAGCTCACCTACCAGACAGAGGAAGACAAGAAGAACTTAATGCGGCTGCA
G
GACCTGGTGGACAAGCTACAGTTGAAGGTGAAGGCCTACAAGCGCCAGGCTGAGGAGGCGGAGGAGCAG
GCC
AACACCAACCTGTCCAAGTTCCGCAAGGTGCAGCACGAGCTGGATGAGGCGGAGGAGAGGGCGGACA
TC
GCCGAGTCCCAGGTCAACAAGCTGCGGGCCAAGAGCCGGGACATTGGTGCCAAGAAGATGCACGACGA
G
GAATAA


Translation (1938 aa):
MTDAQMADFGAAAQYLRKSEKERLEAQTRPFDIRTECFVPDDKEEYVKAKVVSREGGKVTAETENGKTVT
I
KEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIY
TYSGLFCVTVNPYKWLPVYNAEVVA
A
YRGKKRSEAPPHIFSISDNAYQYMLT
DRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRSKKENP
N
ANK
GTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKA
E
RNYHIFYQILSNKKPELL
DMLLVTNNPYDYAFVSQGEVSVASIDDSEELLATDSAFDVLSFTAEEKAGV
Y
KLTGAIMHYGNMKFKQKQREEQAEPDGTE
DADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQ
V
YYSIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFD
FNSFEQLCINFTNEKLQQFF
N
HHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEK
PMGIMSILEEECMFPKASDMTFKAKLYDNHLGK
S
NNFQKPRNVKGKQEAHFSLVHYAGTVDYNIMGWLEKNKDPLNETVVGLYQKSSLKLMATLFSTYASADT

G
DSGKGKGGKKKGSSFQTVSALHRENLNKLMTNLKTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGV
L
EGIRICRKGFPNRILYGDFRQ
RYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAG
L
LGLLEEMRDERLSRIITRIQAQARGQLMRIEFKKIVER
RDALLVIQWNIRAFMGVKNWPWMKLYFKIKP
L
LKSAETEKEMANMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQA
EQDNLNDAEERCDQL
I
KNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENK
VKNL
T
EEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKSKVKLEQQVDD
LEGSLEQEKKVRMDL
E
RAKRKLEGDLKLTQESIMDLENDKLQLEEKLK
KKEFDISQQNSKIEDEQALALQLQKKLKENQARIEEL
E
EELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEAT
A
AALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAK
ANLEKVSRTLEDQANE
Y
RVKLEEAQRSLNDFTTQRAKLQTEN
GELARQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNA
L
AHALQSSRHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEA
KKKLAQRLQ
D
AEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDK
ILAEWKQKYEESQSELE
S
SQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQ
EEISDLTEQLGEGGKNVHELEKIRKQLEVEKL
E
LQSALEEAE
ASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAETRSR
N
EALRVKKKMEGDLNEMEIQLSQANRIASEAQKHLKNSQAHLK
DTQLQLDDAVHANDDLKENIAIVERRN
N
LLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQ
NTSLINQKKKMESDLTQLQTEVEEAVQEC
R
NAEEKAKKAITD
AAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEAR
V
RELENELEAEQKRNAESVKGMRKSERRIKELTYQ
TEEDKKNLMRLQDLVDKLQLKVKAYKRQAEEAEEQ
A
NTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSRDIGAK
KMHDEE



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser