NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS37528.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37528.1 Public Mus musculus 17 Fkbp5 16 104 75 CCDS HistoryNCBI Gene:14229Re-query CCDS DB by CCDS ID:37528.1Re-query CCDS DB by GeneID:14229See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 37528.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000079413 ENSMUSP00000078382 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000079413Link to Ensembl Protein Viewer:ENSMUSP00000078382Re-query CCDS DB by Nucleotide ID:ENSMUST00000079413Re-query CCDS DB by Protein ID:ENSMUSP00000078382
Original member Current member EBI,WTSI ENSMUST00000114792 ENSMUSP00000110440 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000114792Link to Ensembl Protein Viewer:ENSMUSP00000110440Re-query CCDS DB by Nucleotide ID:ENSMUST00000114792Re-query CCDS DB by Protein ID:ENSMUSP00000110440
Original member Current member EBI,WTSI ENSMUST00000177939 ENSMUSP00000136245 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000177939Link to Ensembl Protein Viewer:ENSMUSP00000136245Re-query CCDS DB by Nucleotide ID:ENSMUST00000177939Re-query CCDS DB by Protein ID:ENSMUSP00000136245
Original member Current member EBI,WTSI OTTMUST00000059380 OTTMUSP00000028876 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000059380Link to Vega Protein Viewer:OTTMUSP00000028876Re-query CCDS DB by Nucleotide ID:OTTMUST00000059380Re-query CCDS DB by Protein ID:OTTMUSP00000028876
Original member Current member EBI,WTSI OTTMUST00000059383 OTTMUSP00000028878 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000059383Link to Vega Protein Viewer:OTTMUSP00000028878Re-query CCDS DB by Nucleotide ID:OTTMUST00000059383Re-query CCDS DB by Protein ID:OTTMUSP00000028878
Original member Current member NCBI NM_010220.4 NP_034350.1 Accepted alive Link to Nucleotide Sequence:NM_010220.4Link to Protein Sequence:NP_034350.1Re-query CCDS DB by Nucleotide ID:NM_010220Re-query CCDS DB by Protein ID:NP_034350Link to BLink:NP_034350.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034350.1 456 Q64378 456 100% 0 0

Chromosomal Locations for CCDS 37528.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 28401047 28401151 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 28402609 28402848 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 28406085 28406270 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 28410510 28410593 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 28412034 28412124 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 28415869 28416025 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 28428352 28428466 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 28429221 28429363 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 28437992 28438136 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 28440928 28441032 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1371 nt):
ATGACTACTGATGAGGGCACCAGTAACAATGGAGAGAACCCAGCAGCCACCATGACTGAGCAGGGTGAAG
AT
ATCACTACGAAGAAAGACAGAGGAGTATTAAAGATTGTCAAAAGAGTGGGGACTAGTGACGAGGCCCC
A
ATGTTTGGTGACAAAGTTTATGTCCACTACAAAGGGATGTTGTCAGATGGAAAGAAGTTTGATTCCAGT
CAT
GACAGAAAGAAGCCATTTGCCTTTAGCCTTGGCCAAGGCCAGGTTATCAAAGCCTGGGACATTGGGG
TG
TCTACTATGAAGAAAGGCGAGATCTGCCATTTATTATGTAAACCAGAATATGCTTATGGCTCGGCTGG
C
CACCTCCAAAAAATTCCATCAAATGCAACTCTCTTTTTTGAGATTGAGCTCCTTGATTTCAAAGGTGAG
GAT
TTATTTGAAGATTCAGGCGTTATCCGTAGAATCAAACGGAAAGGCGAGGGATACTCAAACCCAAACG
AA
GGAGCAACGGTAAAAGTCCACCTGGAAGGCTGCTGTGGTGGAAGGACATTTGATTGCCGAGATGTGGT
G
TTCGTTGTTGGGGAAGGAGAAGACCACGACATTCCGATTGGGATCGACAAAGCCCTGGTGAAGATGCAG
AGA
GAAGAACAGTGTATTCTATATCTTGGACCACGCTATGGTTTTGGAGAAGCCGGGAAGCCTAAGTTTG
GC
ATTGACCCCAATGCTGAGCTTATGTACGAGGTCACCCTTAAGAGCTTCGAGAAGGCCAAAGAATCTTG
G
GAGATGGACACCAAAGAAAAGCTGACGCAGGCTGCCATCGTGAAAGAGAAGGGAACTGTGTACTTCAAG
GGA
GGCAAGTACACGCAGGCCGTGATTCAGTACAGGAAGATAGTGTCCTGGCTGGAGATGGAATACGGCC
TG
TCAGAGAAGGAGTCCAAAGCCTCAGAGTCGTTCCTCCTCGCAGCCTTCCTGAACCTGGCCATGTGCTA
C
CTGAAGCTCCGAGAGTACAACAAAGCCGTGGAGTGCTGCGACAAGGCCCTTGGACTGGACAGTGCCAAT
GAG
AAAGGCTTGTACAGAAGGGGCGAGGCCCAGCTGCTCATGAATGACTTTGAGTCGGCCAAGGGCGACT
TC
GAGAAGGTGTTGGCAGTCAATCCTCAGAACAGGGCCGCTCGCCTGCAGATCTCCATGTGCCAGAGGAA
G
GCGAAGGAGCACAACGAGCGGGACCGCAGGGTGTACGCCAACATGTTCAAGAAGTTCGCAGAGCGGGAC
GCA
AAGGAGGAAGCCAGCAAAGCTGGGAGCAAGAAGGCTGTAGAAGGAGCCGCTGGCAAACAACACGAGA
GT
CAGGCCATGGAAGAAGGAAAGGCCAAAGGCCATGTATGA


Translation (456 aa):
MTTDEGTSNNGENPAATMTEQGEDITTKKDRGVLKIVKRVGTSDEAPMFGDKVYVHYKGMLSDGKKFDSS
H
DRKKPFAFSLGQ
GQVIKAWDIGVSTMKKGEICHLLCKPEYAYGSAGHLQKIPSNATLFFEIELLDFKGE
D
LFEDSGVIRRIKRKGEGYSNPNEGATVK
VHLEGCCGGRTFDCRDVVFVVGEGEDHDIPIGIDKALVKMQ
R
EEQCILYLGP
RYGFGEAGKPKFGIDPNAELMYEVTLKSFEKAKESWEMDTKEKLTQAAIVKEKGTVYFK
G
GKYTQAVIQYRKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYNKAVECCDK
ALGLDSAN
E
KGLYRRGEAQLLMNDFESAKGDFEKVLAVNPQNRAARLQISMCQRKAKEHNERDRRVYANMFKKFAERD
A
K
EEASKAGSKKAVEGAAGKQHESQAMEEGKAKGHV



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser