NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16463.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16463.1 Public Mus musculus 2 Rag1 16 104 75 CCDS HistoryNCBI Gene:19373Re-query CCDS DB by CCDS ID:16463.1Re-query CCDS DB by GeneID:19373

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 16463.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000078494 ENSMUSP00000077584 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000078494Link to Ensembl Protein Viewer:ENSMUSP00000077584Re-query CCDS DB by Nucleotide ID:ENSMUST00000078494Re-query CCDS DB by Protein ID:ENSMUSP00000077584
Original member Current member EBI,WTSI OTTMUST00000034580 OTTMUSP00000015477 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000034580Link to Vega Protein Viewer:OTTMUSP00000015477Re-query CCDS DB by Nucleotide ID:OTTMUST00000034580Re-query CCDS DB by Protein ID:OTTMUSP00000015477
Original member Current member NCBI NM_009019.2 NP_033045.2 Accepted alive Link to Nucleotide Sequence:NM_009019.2Link to Protein Sequence:NP_033045.2Re-query CCDS DB by Nucleotide ID:NM_009019Re-query CCDS DB by Protein ID:NP_033045Link to BLink:NP_033045.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033045.2 1040 P15919 1040 100% 0 0

Chromosomal Locations for CCDS 16463.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 101641673 101644795 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3123 nt):
ATGGCTGCCTCCTTGCCGTCTACCCTGAGCTTCAGTTCTGCACCCGATGAAATTCAACACCCACAAATCA
AA
TTTTCCGAGTGGAAATTTAAGCTGTTTAGGGTGAGATCCTTTGAAAAGGCACCCGAAGAAGCACAGAA
G
GAGAAGGATTCCTCAGAGGGGAAACCTTACCTAGAACAGTCTCCAGTAGTTCCAGAGAAGCCTGGTGGT
CAG
AACTCAATTCTGACTCAACGAGCACTGAAACTCCATCCTAAATTTTCAAAGAAATTCCATGCTGATG
GG
AAGTCAAGCGACAAAGCAGTTCACCAAGCCAGGCTTAGACACTTCTGCCGCATCTGTGGGAATCGTTT
C
AAGAGTGACGGGCACAGCCGGAGATACCCAGTCCACGGGCCCGTGGACGCTAAAACCCAAAGTCTTTTC
CGA
AAGAAGGAAAAAAGAGTCACTTCCTGGCCAGACCTCATTGCCAGGATTTTCCGGATCGACGTGAAGG
CA
GATGTTGACTCCATCCACCCGACGGAATTCTGCCATGACTGTTGGAGCATCATGCACAGAAAGTTCAG
C
AGTTCCCACAGTCAGGTCTACTTCCCAAGGAAAGTGACCGTGGAGTGGCACCCCCACACACCGTCCTGT
GAC
ATCTGTTTTACTGCCCATCGGGGACTCAAGAGGAAGAGACATCAGCCCAATGTGCAGCTCAGCAAGA
AA
CTAAAAACTGTGCTCAACCACGCGAGACGGGACCGTCGCAAGAGAACTCAGGCTAGGGTCAGCAGCAA
G
GAAGTCCTGAAGAAGATCTCCAACTGCAGTAAGATTCATCTCAGTACCAAGCTTCTTGCCGTGGACTTC
CCA
GCACACTTTGTGAAATCCATCTCCTGCCAGATATGCGAACACATTCTGGCTGATCCCGTGGAGACCA
GC
TGCAAGCATCTATTCTGTAGGATCTGCATTCTCAGATGTCTCAAAGTCATGGGCAGCTATTGTCCCTC
T
TGCCGATATCCGTGCTTCCCTACTGACCTGGAGAGCCCAGTGAAGTCCTTTCTGAACATCTTGAATTCT
CTC
ATGGTCAAGTGTCCCGCGCAAGATTGCAATGAGGAAGTGAGTCTGGAAAAATATAACCACCATGTGT
CA
AGCCACAAAGAATCTAAAGAGACTTTGGTGCATATCAATAAAGGGGGACGGCCTCGCCAGCATCTCCT
G
TCACTGACGAGAAGGGCGCAGAAACATCGGCTGAGGGAGCTCAAGATTCAAGTCAAAGAATTTGCTGAC
AAA
GAAGAAGGTGGAGATGTGAAGGCTGTCTGCTTGACATTGTTTCTCCTGGCACTGAGGGCGAGGAATG
AG
CACAGGCAAGCTGATGAATTAGAGGCCATCATGCAAGGCAGGGGCTCCGGGCTTCAACCAGCTGTTTG
C
TTGGCCATCCGTGTCAATACCTTCCTCAGCTGTAGCCAATACCATAAGATGTACAGGACTGTGAAAGCT
ATC
ACTGGGAGGCAGATTTTTCAACCTTTGCATGCTCTTCGGAATGCCGAGAAAGTCCTTCTGCCAGGCT
AC
CATCCCTTTGAGTGGCAGCCCCCACTGAAGAATGTGTCCTCCAGAACTGATGTTGGAATTATTGATGG
G
CTGTCTGGACTTGCCTCCTCTGTGGATGAGTACCCAGTAGATACCATTGCGAAGAGGTTCCGCTACGAC
TCT
GCTTTGGTGTCTGCTTTGATGGACATGGAAGAAGACATCTTGGAAGGCATGAGATCCCAAGATCTTG
AT
GACTACCTGAATGGTCCCTTCACAGTGGTGGTAAAGGAGTCTTGCGATGGAATGGGGGATGTGAGTGA
G
AAGCACGGGAGTGGGCCCGCAGTTCCAGAAAAGGCCGTTCGTTTCTCTTTCACAGTCATGAGAATTACG
ATA
GAGCATGGTTCACAGAACGTGAAGGTGTTTGAGGAACCCAAGCCCAATTCTGAACTGTGTTGCAAGC
CG
TTGTGTCTTATGCTGGCAGATGAGTCTGACCATGAGACCCTTACTGCTATTCTAAGCCCCCTCATTGC
C
GAGAGGGAGGCCATGAAGAGCAGTGAATTAACGCTGGAGATGGGAGGCATCCCCAGGACTTTTAAATTC
ATC
TTCAGGGGCACTGGATACGATGAAAAACTTGTCCGGGAAGTAGAAGGCTTGGAAGCTTCTGGCTCAG
TC
TACATCTGTACACTCTGTGACACCACCCGTTTGGAAGCCTCTCAGAATCTTGTCTTCCACTCCATAAC
C
AGAAGCCACGCCGAGAACCTGCAGCGCTATGAGGTCTGGCGGTCCAATCCGTATCATGAGTCCGTGGAA
GAG
CTCCGGGACCGGGTGAAAGGGGTCTCTGCCAAACCTTTCATCGAGACAGTCCCTTCCATAGATGCGC
TT
CACTGTGACATTGGCAATGCAGCTGAATTCTATAAGATTTTCCAGCTGGAGATAGGGGAAGTGTATAA
A
CATCCCAATGCCTCTAAAGAGGAAAGGAAGAGATGGCAGGCCACGCTGGACAAACATCTCCGGAAAAGG
ATG
AACTTAAAACCAATCATGAGGATGAATGGCAACTTTGCCCGGAAGCTTATGACCCAAGAGACTGTAG
AC
GCAGTTTGTGAGTTAATTCCTTCTGAGGAGAGGCATGAAGCTCTCAGGGAGCTCATGGACCTTTACCT
G
AAGATGAAACCCGTGTGGCGCTCTTCATGTCCCGCTAAAGAGTGTCCAGAGTCCCTCTGTCAGTACAGT
TTC
AACTCACAGCGTTTCGCGGAACTCCTCTCCACCAAGTTCAAATATAGATACGAGGGCAAAATCACCA
AT
TACTTTCACAAAACCTTGGCACATGTCCCTGAAATTATTGAAAGGGATGGCTCTATCGGGGCCTGGGC
A
AGTGAGGGAAATGAATCGGGTAACAAGCTGTTTAGACGGTTTCGGAAAATGAATGCCAGGCAGTCCAAG
TGC
TATGAGATGGAAGATGTCCTGAAACATCACTGGCTGTATACTTCAAAATACCTCCAGAAGTTTATGA
AT
GCTCATAACGCGTTAAAAAGCTCTGGGTTTACCATGAACTCAAAGGAGACCTTAGGGGACCCTTTGGG
C
ATTGAGGACTCTCTGGAAAGCCAAGATTCAATGGAGTTTTAA


Translation (1040 aa):
MAASLPSTLSFSSAPDEIQHPQIKFSEWKFKLFRVRSFEKAPEEAQKEKDSSEGKPYLEQSPVVPEKPGG
Q
NSILTQRALKLHPKFSKKFHADGKSSDKAVHQARLRHFCRICGNRFKSDGHSRRYPVHGPVDAKTQSLF
R
KKEKRVTSWPDLIARIFRIDVKADVDSIHPTEFCHDCWSIMHRKFSSSHSQVYFPRKVTVEWHPHTPSC
D
ICFTAHRGLKRKRHQPNVQLSKKLKTVLNHARRDRRKRTQARVSSKEVLKKISNCSKIHLSTKLLAVDF
P
AHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLESPVKSFLNILNS
L
MVKCPAQDCNEEVSLEKYNHHVSSHKESKETLVHINKGGRPRQHLLSLTRRAQKHRLRELKIQVKEFAD
K
EEGGDVKAVCLTLFLLALRARNEHRQADELEAIMQGRGSGLQPAVCLAIRVNTFLSCSQYHKMYRTVKA
I
TGRQIFQPLHALRNAEKVLLPGYHPFEWQPPLKNVSSRTDVGIIDGLSGLASSVDEYPVDTIAKRFRYD
S
ALVSALMDMEEDILEGMRSQDLDDYLNGPFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTVMRIT
I
EHGSQNVKVFEEPKPNSELCCKPLCLMLADESDHETLTAILSPLIAEREAMKSSELTLEMGGIPRTFKF
I
FRGTGYDEKLVREVEGLEASGSVYICTLCDTTRLEASQNLVFHSITRSHAENLQRYEVWRSNPYHESVE
E
LRDRVKGVSAKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKHPNASKEERKRWQATLDKHLRKR
M
NLKPIMRMNGNFARKLMTQETVDAVCELIPSEERHEALRELMDLYLKMKPVWRSSCPAKECPESLCQYS
F
NSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWASEGNESGNKLFRRFRKMNARQSK
C
YEMEDVLKHHWLYTSKYLQKFMNAHNALKSSGFTMNSKETLGDPLGIEDSLESQDSMEF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser