NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29085.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29085.1 Public Mus musculus 18 Ttr 16 104 75 CCDS HistoryNCBI Gene:22139Re-query CCDS DB by CCDS ID:29085.1Re-query CCDS DB by GeneID:22139See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 29085.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000075312 ENSMUSP00000074783 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000075312Link to Ensembl Protein Viewer:ENSMUSP00000074783Re-query CCDS DB by Nucleotide ID:ENSMUST00000075312Re-query CCDS DB by Protein ID:ENSMUSP00000074783
Original member Current member NCBI NM_013697.5 NP_038725.1 Accepted alive Link to Nucleotide Sequence:NM_013697.5Link to Protein Sequence:NP_038725.1Re-query CCDS DB by Nucleotide ID:NM_013697Re-query CCDS DB by Protein ID:NP_038725Link to BLink:NP_038725.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038725.1 147 P07309 147 100% 0 0

Chromosomal Locations for CCDS 29085.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 18Link to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 20665439 20665507 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 20666456 20666586 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 20669979 20670114 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 20673631 20673738 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (444 nt):
ATGGCTTCCCTTCGACTCTTCCTCCTTTGCCTCGCTGGACTGGTATTTGTGTCTGAAGCTGGCCCCGCGG
GT
GCTGGAGAATCCAAATGTCCTCTGATGGTCAAAGTCCTGGATGCTGTCCGAGGCAGCCCTGCTGTAGA
C
GTGGCTGTAAAAGTGTTCAAAAAGACCTCTGAGGGATCCTGGGAGCCCTTTGCCTCTGGGAAGACCGCG
GAG
TCTGGAGAGCTGCACGGGCTCACCACAGATGAGAAGTTTGTAGAAGGAGTGTACAGAGTAGAACTGG
AC
ACCAAATCGTACTGGAAGACACTTGGCATTTCCCCGTTCCATGAATTCGCGGATGTGGTTTTCACAGC
C
AACGACTCTGGCCATCGCCACTACACCATCGCAGCCCTGCTCAGCCCATACTCCTACAGCACCACGGCT
GTC
GTCAGCAACCCCCAGAATTGA


Translation (147 aa):
MASLRLFLLCLAGLVFVSEAGPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTA
E
SGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFAD
VVFTANDSGHRHYTIAALLSPYSYSTTA
V
VSNPQN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser