NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS35773.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35773.1 Public Mus musculus 1 Apoa2 16 104 75 CCDS HistoryNCBI Gene:11807Re-query CCDS DB by CCDS ID:35773.1Re-query CCDS DB by GeneID:11807

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 35773.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000005824 ENSMUSP00000005824 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000005824Link to Ensembl Protein Viewer:ENSMUSP00000005824Re-query CCDS DB by Nucleotide ID:ENSMUST00000005824Re-query CCDS DB by Protein ID:ENSMUSP00000005824
Original member Current member EBI,WTSI ENSMUST00000111319 ENSMUSP00000106951 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111319Link to Ensembl Protein Viewer:ENSMUSP00000106951Re-query CCDS DB by Nucleotide ID:ENSMUST00000111319Re-query CCDS DB by Protein ID:ENSMUSP00000106951
Original member Current member EBI,WTSI ENSMUST00000111320 ENSMUSP00000106952 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111320Link to Ensembl Protein Viewer:ENSMUSP00000106952Re-query CCDS DB by Nucleotide ID:ENSMUST00000111320Re-query CCDS DB by Protein ID:ENSMUSP00000106952
Original member Current member EBI,WTSI ENSMUST00000111321 ENSMUSP00000106953 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111321Link to Ensembl Protein Viewer:ENSMUSP00000106953Re-query CCDS DB by Nucleotide ID:ENSMUST00000111321Re-query CCDS DB by Protein ID:ENSMUSP00000106953
Original member Current member EBI,WTSI OTTMUST00000051427 OTTMUSP00000024197 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000051427Link to Vega Protein Viewer:OTTMUSP00000024197Re-query CCDS DB by Nucleotide ID:OTTMUST00000051427Re-query CCDS DB by Protein ID:OTTMUSP00000024197
Original member Current member EBI,WTSI OTTMUST00000051428 OTTMUSP00000024198 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000051428Link to Vega Protein Viewer:OTTMUSP00000024198Re-query CCDS DB by Nucleotide ID:OTTMUST00000051428Re-query CCDS DB by Protein ID:OTTMUSP00000024198
Original member Current member EBI,WTSI OTTMUST00000051437 OTTMUSP00000024207 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000051437Link to Vega Protein Viewer:OTTMUSP00000024207Re-query CCDS DB by Nucleotide ID:OTTMUST00000051437Re-query CCDS DB by Protein ID:OTTMUSP00000024207
Original member Current member EBI,WTSI OTTMUST00000051438 OTTMUSP00000024208 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000051438Link to Vega Protein Viewer:OTTMUSP00000024208Re-query CCDS DB by Nucleotide ID:OTTMUST00000051438Re-query CCDS DB by Protein ID:OTTMUSP00000024208
Original member Current member NCBI NM_013474.2 NP_038502.2 Accepted alive Link to Nucleotide Sequence:NM_013474.2Link to Protein Sequence:NP_038502.2Re-query CCDS DB by Nucleotide ID:NM_013474Re-query CCDS DB by Protein ID:NP_038502Link to BLink:NP_038502.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038502.2 102 P09813 102 100% 0 0

Chromosomal Locations for CCDS 35773.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

Chromosome Start Stop Links
1 171225315 171225366 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171225666 171225798 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171226143 171226266 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (309 nt):
ATGAAGCTGCTCGCAATGGTCGCACTGCTGGTCACCATCTGTAGCCTGGAAGGAGCTTTGGTTAAGAGAC
AG
GCAGACGGACCGGATATGCAGAGCCTGTTCACTCAATACTTTCAGAGCATGACTGATTATGGCAAAGA
T
TTGATGGAGAAGGCCAAGACCTCAGAGATTCAGAGCCAGGCCAAGGCATACTTTGAGAAGACACACGAG
CAG
CTGACACCCCTTGTCAGGTCAGCAGGAACTAGTCTGGTGAACTTCTTCAGCAGTTTAATGAACCTTG
AG
GAGAAACCGGCTCCTGCGGCTAAGTGA


Translation (102 aa):
MKLLAMVALLVTICSLEGALVKRQADGPDMQSLFTQYFQSMTDYGKDLMEKAKTSEIQSQAKAYFEKTHE
Q
LTPLVRSAGTSLVNFFSSLMNLEEKPAPAAK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser