NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30210.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30210.1 Public Mus musculus X Abcd1 16 104 75 CCDS HistoryNCBI Gene:11666Re-query CCDS DB by CCDS ID:30210.1Re-query CCDS DB by GeneID:11666

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 30210.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000002084 ENSMUSP00000002084 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000002084Link to Ensembl Protein Viewer:ENSMUSP00000002084Re-query CCDS DB by Nucleotide ID:ENSMUST00000002084Re-query CCDS DB by Protein ID:ENSMUSP00000002084
Original member Current member EBI,WTSI OTTMUST00000042898 OTTMUSP00000019283 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000042898Link to Vega Protein Viewer:OTTMUSP00000019283Re-query CCDS DB by Nucleotide ID:OTTMUST00000042898Re-query CCDS DB by Protein ID:OTTMUSP00000019283
Original member Current member NCBI NM_007435.1 NP_031461.1 Accepted alive Link to Nucleotide Sequence:NM_007435.1Link to Protein Sequence:NP_031461.1Re-query CCDS DB by Nucleotide ID:NM_007435Re-query CCDS DB by Protein ID:NP_031461Link to BLink:NP_031461.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031461.1 736 P48410 736 100% 0 0

Chromosomal Locations for CCDS 30210.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

Chromosome Start Stop Links
X 73717031 73717930 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 73720914 73721094 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 73728984 73729126 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 73729209 73729377 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 73730794 73730888 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 73734009 73734154 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 73734462 73734607 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 73736790 73736874 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 73737103 73737228 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 73737312 73737531 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2211 nt):
ATGCCGGTGCTCTCCACTCCCCGGCCCTCACGGGTGACCACGCTGAAGCGCACAGCTGTGGTCCTGGCCC
TC
ACAGCCTATGGAGTCCACAAAATCTACCCTCTAGTACGGCAGTGTCTGACTCCTGCCAGAGGTCCTCA
G
GTGCCAGCTGGGGAGCCCACTCAAGAGGCCTCTGGAGCCACCGCAACCAAGGCTGGCATGAACCGGGTA
TTC
CTGCAGCGGCTCTTGGCGCTCCTGAGGCTGCTGTTCCCCCGAGTCTTGTGCCGGGAAACAGGGCTGC
TG
GCCCTGCATTCTGCTGCCCTGGTAAGCCGAACTTTCCTGTCTGTGTATGTTGCCCGCCTGGACGGCAG
A
CTGGCCCGCTGCATTGTACGTAAGGACCCGCGGGCCTTTAGCTGGCAACTGCTGCAGTGGCTCCTCATC
GCC
CTTCCTGCCACTTTCATCAACAGTGCCATCCGCTACCTAGAGGGCCAGCTGGCTCTTTCTTTCCGAA
GC
CGTCTAGTAGCTCATGCCTATGGACTCTACTTCTCCCAACAGACTTACTACCGAGTAAGCAACATGGA
T
GGACGACTTCGAAACCCTGATCAGTCTCTGACAGAGGATGTGGTAGCCTTTGCTGCCTCTGTAGCCCAC
CTT
TATTCCAACCTGACCAAGCCACTCCTGGATGTGGCTGTGACCTCCTACACTCTCCTTCGAGCTGCCC
GA
TCCCGAGGAGCTGGCACAGCCTGGCCCTCAGCCATCGCTGGCCTGGTGGTGTTCCTCACAGCCAACGT
G
CTTCGAGCCTTCTCTCCCAAGTTTGGGGAGCTAGTGGCAGAGGAGGCACGGCGAAAGGGGGAACTGCGC
TAC
ATGCACTCTCGAGTGGTGGCCAACTCAGAGGAAATTGCCTTCTACGGGGGCCATGAGGTGGAACTGG
CA
CTACTACAGCACTCCTATCAAGACCTAGCTTCACAGATCAACCTCATCCTGCTTGAGCGCCTATGGTA
T
GTCATGCTGGAACAGTTCCTCATGAAATATGTGTGGAGTGCATCTGGCCTGCTCATGGTAGCTGTCCCC
ATC
ATCACAGCCACTGGCTATGCAGAGTCAGACTCAGAAGCCATGAAGAAGGCAGCCTTGGAAATGAAGG
AA
GAGGAGCTGGTTAGTGAGCGTACAGAAGCTTTCACCATTGCCCGAAACCTCCTCACAGCTGCTGCAGA
T
GCCACCGAAAGGATCATGTCATCTTATAAGGAGGTGACAGAGCTGGCTGGCTACACAGCCAGGGTGTAC
GAG
ATGTTCCAGGTATTTGAAGATGTCAAACACTGTCGTTTTAAGAGGACAGGAGATCTAGAGGAGGCTC
AG
GCTGGGCCTGGGGTCATGGTACAGTCTGGTGTCCATGTAGAGGGGCCCCTGAAGATCCAAGGCCAAGT
T
GTGGATGTGGAGCAGGGGATCATCTGTGAGAACATCCCTATCATCACACCCACTGGAGAGGTGGTGGTG
GCC
AGCCTCAACATCAGGGTGGAGGAAGGCATGCACCTGCTCATCACAGGCCCCAATGGCTGTGGCAAGA
GT
TCTCTGTTCCGAATCCTAGGTGGACTCTGGCCCACATACAGTGGTGTACTCTATAAGCCCCCACCCCA
G
CGCATGTTCTATATCCCTCAGAGGCCCTACATGTCCGTGGGCTCCTTGCGTGACCAAGTGATCTATCCC
GAC
TCTGCGGAAGACATGCGGAGGAAGGGCTGCTCGGAGCAGCAGCTGGAAGCAATCCTGGGCATCGTGC
AT
CTCCGCCACATCCTGCAACGGGAGGGAGGTTGGGAGGCAGTGTGTGACTGGAAGGACGTCCTGTCTGG
A
GGTGAGAAGCAGAGGATTGGTATGGCGCGCATGTTCTACCACAGGCCCAAGTACGCCCTCCTGGATGAG
TGC
ACTAGTGCCGTGAGCATTGATGTGGAAGGCAAGATCTTCCAAGCAGCCAAAGATGCTGGTATCGCAC
TG
CTCTCCATCACCCATCGACCCTCCCTATGGAAGTACCACACACACTTGCTGCAGTTTGATGGGGAAGG
A
GGCTGGAAGTTTGAGAAGCTGGATTCTGCTGCCCGCCTGAGCCTGACTGAAGAGAAGCAGCGCCTGGAG
CAG
CAACTGGCGGGCATCCCCAAGATGCAGGGGCGCCTTCAGGAGCTCCGCCAGATCCTTGGCGAAGCTG
CA
GCTCCAGTTCAACCCCTGGTCCCAGGAGTCCCCACTTGA


Translation (736 aa):
MPVLSTPRPSRVTTLKRTAVVLALTAYGVHKIYPLVRQCLTPARGPQVPAGEPTQEASGATATKAGMNRV
F
LQRLLALLRLLFPRVLCRETGLLALHSAALVSRTFLSVYVARLDGRLARCIVRKDPRAFSWQLLQWLLI
A
LPATFINSAIRYLEGQLALSFRSRLVAHAYGLYFSQQTYYRVSNMDGRLRNPDQSLTEDVVAFAASVAH
L
YSNLTKPLLDVAVTSYTLLRAARSRGAGTAWPSAIAGLVVFLTANVLRAFSPKFGELVAEEARRKGELR
Y
MHSRVVANSEEIAFYGGHE
VELALLQHSYQDLASQINLILLERLWYVMLEQFLMKYVWSASGLLMVAVP
I
ITATGYAES
DSEAMKKAALEMKEEELVSERTEAFTIARNLLTAAADATERIMSSYKEVTELAGYTARVY
E
MFQVFEDVKHCRFKRTGDLEEAQAGPGVMVQSGVHVEGPLKIQ
GQVVDVEQGIICENIPIITPTGEVVV
A
SLNIR
VEEGMHLLITGPNGCGKSSLFRILGGLWPTYSGVLYKPPPQRMFYIPQRPYMSVGSLRDQVIYP
D
SAEDMRRKGCSEQQLEAILGIVHLRHILQREG
GWEAVCDWKDVLSGGEKQRIGMARMFYHRPKYALLDE
C
TSAVSIDVEGKIFQAAKDAGIALLSITHRPSL
WKYHTHLLQFDGEGGWKFEKLDSAARLSLTEEKQRLE
Q
QLAGIPKMQGRLQELRQILGEAAAPVQPLVPGVPT




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser