NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3509.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3509.1 Public Homo sapiens 4 REST 15 105 74 CCDS HistoryNCBI Gene:5978Re-query CCDS DB by CCDS ID:3509.1Re-query CCDS DB by GeneID:5978

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 3509.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000309042 ENSP00000311816 Accepted alive Link to Ensembl Transcript Viewer:ENST00000309042Link to Ensembl Protein Viewer:ENSP00000311816Re-query CCDS DB by Nucleotide ID:ENST00000309042Re-query CCDS DB by Protein ID:ENSP00000311816
Original member Current member EBI,WTSI OTTHUMT00000250691 OTTHUMP00000158972 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000250691Link to Vega Protein Viewer:OTTHUMP00000158972Re-query CCDS DB by Nucleotide ID:OTTHUMT00000250691Re-query CCDS DB by Protein ID:OTTHUMP00000158972
Original member Current member NCBI NM_001193508.1 NP_001180437.1 Accepted alive Link to Nucleotide Sequence:NM_001193508.1Link to Protein Sequence:NP_001180437.1Re-query CCDS DB by Nucleotide ID:NM_001193508Re-query CCDS DB by Protein ID:NP_001180437Link to BLink:NP_001180437.1
Original member Current member NCBI NM_005612.4 NP_005603.3 Accepted alive Link to Nucleotide Sequence:NM_005612.4Link to Protein Sequence:NP_005603.3Re-query CCDS DB by Nucleotide ID:NM_005612Re-query CCDS DB by Protein ID:NP_005603Link to BLink:NP_005603.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001180437.1 1097 Q13127-1 1097 100% 0 0
NP_005603.3 1097 Q13127-1 1097 100% 0 0

Chromosomal Locations for CCDS 3509.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '+' strand of Chromosome 4 (NC_000004.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 57776805 57777702 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 57785953 57786036 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 57796007 57798318 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3294 nt):
ATGGCCACCCAGGTAATGGGGCAGTCTTCTGGAGGAGGAGGGCTGTTTACCAGCAGTGGCAACATTGGAA
TG
GCCCTGCCTAACGACATGTATGACTTGCATGACCTTTCCAAAGCTGAACTGGCCGCACCTCAGCTTAT
T
ATGCTGGCAAATGTGGCCTTAACTGGGGAAGTAAATGGCAGCTGCTGTGATTACCTGGTCGGTGAAGAA
AGA
CAGATGGCAGAACTGATGCCGGTTGGGGATAACAACTTTTCAGATAGTGAAGAAGGAGAAGGACTTG
AA
GAGTCTGCTGATATAAAAGGTGAACCTCATGGACTGGAAAACATGGAACTGAGAAGTTTGGAACTCAG
C
GTCGTAGAACCTCAGCCTGTATTTGAGGCATCAGGTGCTCCAGATATTTACAGTTCAAATAAAGATCTT
CCC
CCTGAAACACCTGGAGCGGAGGACAAAGGCAAGAGCTCGAAGACCAAACCCTTTCGCTGTAAGCCAT
GC
CAATATGAAGCAGAATCTGAAGAACAGTTTGTGCATCACATCAGAGTTCACAGTGCTAAGAAATTTTT
T
GTGGAAGAGAGTGCAGAGAAGCAGGCAAAAGCCAGGGAATCTGGCTCTTCCACTGCAGAAGAGGGAGAT
TTC
TCCAAGGGCCCCATTCGCTGTGACCGCTGCGGCTACAATACTAATCGATATGATCACTATACAGCAC
AC
CTGAAACACCACACCAGAGCTGGGGATAATGAGCGAGTCTACAAGTGTATCATTTGCACATACACAAC
A
GTGAGCGAGTATCACTGGAGGAAACATTTAAGAAACCATTTTCCAAGGAAAGTATACACATGTGGAAAA
TGC
AACTATTTTTCAGACAGAAAAAACAATTATGTTCAGCATGTTAGAACTCATACAGGAGAACGCCCAT
AT
AAATGTGAACTTTGTCCTTACTCAAGTTCTCAGAAGACTCATCTAACTAGACATATGCGTACTCATTC
A
GGTGAGAAGCCATTTAAATGTGATCAGTGCAGTTATGTGGCCTCTAATCAACATGAAGTAACCCGCCAT
GCA
AGACAGGTTCACAATGGGCCTAAACCTCTTAATTGCCCACACTGTGATTACAAAACAGCAGATAGAA
GC
AACTTCAAAAAACATGTAGAGCTACATGTGAACCCACGGCAGTTCAATTGCCCTGTATGTGACTATGC
A
GCTTCCAAGAAGTGTAATCTACAGTATCACTTCAAATCTAAGCATCCTACTTGTCCTAATAAAACAATG
GAT
GTCTCAAAAGTGAAACTAAAGAAAACCAAAAAACGAGAGGCTGACTTGCCTGATAATATTACCAATG
AA
AAAACAGAAATAGAACAAACAAAAATAAAAGGGGATGTGGCTGGAAAGAAAAATGAAAAGTCCGTCAA
A
GCAGAGAAAAGAGATGTCTCAAAAGAGAAAAAGCCTTCTAATAATGTGTCAGTGATCCAGGTGACTACC
AGA
ACTCGAAAATCAGTAACAGAGGTGAAAGAGATGGATGTGCATACAGGAAGCAATTCAGAAAAATTCA
GT
AAAACTAAGAAAAGCAAAAGGAAGCTGGAAGTTGACAGCCATTCTTTACATGGTCCTGTGAATGATGA
G
GAATCTTCAACAAAAAAGAAAAAGAAGGTAGAAAGCAAATCCAAAAATAATAGTCAGGAAGTGCCAAAG
GGT
GACAGCAAAGTGGAGGAGAATAAAAAGCAAAATACTTGCATGAAAAAAAGTACAAAGAAGAAAACTC
TG
AAAAATAAATCAAGTAAGAAAAGCAGTAAGCCTCCTCAGAAGGAACCTGTTGAGAAGGGATCTGCTCA
G
ATGGACCCTCCTCAGATGGGGCCTGCTCCCACAGAGGCGGTTCAGAAGGGGCCCGTTCAGGTGGAGCCG
CCA
CCTCCCATGGAGCATGCTCAGATGGAGGGTGCCCAGATACGGCCTGCTCCTGACGAGCCTGTTCAGA
TG
GAGGTGGTTCAGGAGGGGCCTGCTCAGAAGGAGCTGCTGCCTCCCGTGGAGCCTGCTCAGATGGTGGG
T
GCCCAAATTGTACTTGCTCACATGGAGCTGCCTCCTCCCATGGAGACTGCTCAGACGGAGGTTGCCCAA
ATG
GGGCCTGCTCCCATGGAACCTGCTCAGATGGAGGTTGCCCAGGTAGAATCTGCTCCCATGCAGGTGG
TC
CAGAAGGAGCCTGTTCAGATGGAGCTGTCTCCTCCCATGGAGGTGGTCCAGAAGGAGCCTGTTCAGAT
A
GAGCTGTCTCCTCCCATGGAGGTGGTCCAGAAGGAACCTGTTAAGATAGAGCTGTCTCCTCCCATAGAG
GTG
GTCCAGAAGGAGCCTGTTCAGATGGAGTTGTCTCCTCCCATGGGGGTGGTTCAGAAGGAGCCTGCTC
AG
AGGGAGCCACCTCCTCCCAGAGAGCCTCCCCTTCACATGGAGCCAATTTCCAAAAAGCCTCCTCTCCG
A
AAAGATAAAAAGGAAAAGTCTAACATGCAGAGTGAAAGGGCACGGAAGGAGCAAGTCCTTATTGAAGTT
GGC
TTAGTGCCTGTTAAAGATAGCTGGCTTCTAAAGGAAAGTGTAAGCACAGAGGATCTCTCACCACCAT
CA
CCACCACTGCCAAAGGAAAATTTAAGAGAAGAGGCATCAGGAGACCAAAAATTACTCAACACAGGTGA
A
GGAAATAAAGAAGCCCCTCTTCAGAAAGTAGGAGCAGAAGAGGCAGATGAGAGCCTACCTGGTCTTGCT
GCT
AATATCAACGAATCTACCCATATTTCATCCTCTGGACAAAACTTGAATACGCCAGAGGGTGAAACTT
TA
AATGGTAAACATCAGACTGACAGTATAGTTTGTGAAATGAAAATGGACACTGATCAGAACACAAGAGA
G
AATCTCACTGGTATAAATTCAACAGTTGAAGAACCAGTTTCACCAATGCTTCCCCCTTCAGCAGTAGAA
GAA
CGTGAAGCAGTGTCCAAAACTGCACTGGCATCACCTCCTGCTACAATGGCAGCAAATGAGTCTCAGG
AA
ATTGATGAAGATGAAGGCATCCACAGCCATGAAGGAAGTGACCTAAGTGACAACATGTCAGAGGGTAG
T
GATGATTCTGGATTGCATGGGGCTCGGCCAGTTCCACAAGAATCTAGCAGAAAAAATGCAAAGGAAGCC
TTG
GCAGTCAAAGCGGCTAAGGGAGATTTTGTTTGTATCTTCTGTGATCGTTCTTTCAGAAAGGGAAAAG
AT
TACAGCAAACACCTCAATCGCCATTTGGTTAATGTGTACTATCTTGAAGAAGCAGCTCAAGGGCAGGA
G
TAA


Translation (1097 aa):
MATQVMGQSSGGGGLFTSSGNIGMALPNDMYDLHDLSKAELAAPQLIMLANVALTGEVNGSCCDYLVGEE
R
QMAELMPVGDNNFSDSEEGEGLEESADIKGEPHGLENMELRSLELSVVEPQPVFEASGAPDIYSSNKDL
P
PETPGAEDKGKSSKTKPFRCKPCQYEAESEEQFVHHIRVHSAKKFFVEESAEKQAKARESGSSTAEEGD
F
SKGPIRCDRCGYNTNRYDHYTAHLKHHTRAGDNERVYKCIICTYTTVSEYHWRKHLRNHFPRKVYTCGK
C
NYFSDRKNNYVQHVRTHT
GERPYKCELCPYSSSQKTHLTRHMRTHSGEKPFKCDQCSYVASNQHEVTRH
A
RQVHNGPKPLNCPHCDYKTADRSNFKKHVELHVNPRQFNCPVCDYAASKKCNLQYHFKSKHPTCPNKTM
D
VSKVKLKKTKKREADLPDNITNEKTEIEQTKIKGDVAGKKNEKSVKAEKRDVSKEKKPSNNVSVIQVTT
R
TRKSVTEVKEMDVHTGSNSEKFSKTKKSKRKLEVDSHSLHGPVNDEESSTKKKKKVESKSKNNSQEVPK
G
DSKVEENKKQNTCMKKSTKKKTLKNKSSKKSSKPPQKEPVEKGSAQMDPPQMGPAPTEAVQKGPVQVEP
P
PPMEHAQMEGAQIRPAPDEPVQMEVVQEGPAQKELLPPVEPAQMVGAQIVLAHMELPPPMETAQTEVAQ
M
GPAPMEPAQMEVAQVESAPMQVVQKEPVQMELSPPMEVVQKEPVQIELSPPMEVVQKEPVKIELSPPIE
V
VQKEPVQMELSPPMGVVQKEPAQREPPPPREPPLHMEPISKKPPLRKDKKEKSNMQSERARKEQVLIEV
G
LVPVKDSWLLKESVSTEDLSPPSPPLPKENLREEASGDQKLLNTGEGNKEAPLQKVGAEEADESLPGLA
A
NINESTHISSSGQNLNTPEGETLNGKHQTDSIVCEMKMDTDQNTRENLTGINSTVEEPVSPMLPPSAVE
E
REAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLSDNMSEGSDDSGLHGARPVPQESSRKNAKEA
L
AVKAAKGDFVCIFCDRSFRKGKDYSKHLNRHLVNVYYLEEAAQGQE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser