NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS50594.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50594.1 Public Mus musculus 2 Ifih1 16 104 75 CCDS HistoryNCBI Gene:71586Re-query CCDS DB by CCDS ID:50594.1Re-query CCDS DB by GeneID:71586

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 50594.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000112459 ENSMUSP00000108078 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112459Link to Ensembl Protein Viewer:ENSMUSP00000108078Re-query CCDS DB by Nucleotide ID:ENSMUST00000112459Re-query CCDS DB by Protein ID:ENSMUSP00000108078
Original member Current member EBI,WTSI OTTMUST00000099461 OTTMUSP00000055823 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000099461Link to Vega Protein Viewer:OTTMUSP00000055823Re-query CCDS DB by Nucleotide ID:OTTMUST00000099461Re-query CCDS DB by Protein ID:OTTMUSP00000055823
Original member Current member NCBI NM_001164477.1 NP_001157949.1 Accepted alive Link to Nucleotide Sequence:NM_001164477.1Link to Protein Sequence:NP_001157949.1Re-query CCDS DB by Nucleotide ID:NM_001164477Re-query CCDS DB by Protein ID:NP_001157949Link to BLink:NP_001157949.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001157949.1 976 Q8R5F7-2 976 100% 0 0

Chromosomal Locations for CCDS 50594.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 62597909 62598088 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 62598179 62598269 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 62598786 62598976 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 62601390 62601551 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 62603420 62603569 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 62605441 62605700 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 62606181 62606456 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 62606973 62607096 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 62609185 62609301 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 62610441 62610658 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 62611710 62611920 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 62617261 62617484 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 62623393 62623497 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 62639330 62639498 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 62645478 62645930 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2931 nt):
ATGTCGATTGTCTGTTCTGCAGAGGACAGCTTCAGGAATCTCATCTTATTCTTCAGGCCCAGGCTGAAAA
TG
TACATTCAGGTGGAGCCAGTGCTGGACCACCTCATCTTTCTGTCTGCAGAAACCAAAGAGCAGATTCT
T
AAAAAGATCAACACCTGTGGTAACACCAGCGCGGCAGAACTGCTGCTGAGCACCTTGGAGCAGGGACAA
TGG
CCTCTGGGATGGACGCAGATGTTCGTGGAGGCCCTAGAGCACAGTGGCAATCCCCTAGCCGCGCGCT
AT
GTCAAACCCACACTCACTGATCTGCCCTCTCCTTCCTCTGAGACTGCCCATGACGAGTGTCTCCACTT
G
CTGACCCTCCTCCAGCCCACTTTGGTGGACAAACTTCTGATTAACGATGTCTTGGACACTTGCTTCGAG
AAG
GGACTATTGACAGTCGAAGACAGAAATCGGATTTCTGCTGCAGGAAACAGCGGGAATGAGTCAGGTG
TA
AGAGAGCTGCTGAGAAGGATTGTGCAGAAGGAAAACTGGTTTTCTACCTTCCTGGATGTTCTGCGCCA
A
ACTGGAAATGATGCACTATTCCAAGAACTAACAGGTGGAGGCTGCCCAGAAGACAACACAGAATCAGAC
ACA
AGTTTGGCAGAAGGAAGTGTCAGCTGCTTCGATGAAAGTCTTGGACATAACAGCAACATGGGCAGGG
AT
TCAGGCACCATGGGAAGTGATTCAGATGAAAGTGTCATCCAGACAAAAAGAGTATCCCCCGAGCCAGA
A
CTGCAGCTCAGGCCTTACCAAATGGAAGTGGCCCAACCAGCTCTAGATGGGAAGAATATTATTATCTGC
CTC
CCCACGGGGAGTGGGAAAACCAGAGTGGCTGTTTACATCACCAAAGATCACTTAGACAAGAAGAAGC
AG
GCATCTGAATCCGGGAAGGTTATCGTTCTTGTCAATAAGGTAATGTTAGCAGAACAACTTTTCCGAAA
A
GAGTTCAACCCATATTTGAAGAAATGGTATCGAATTATTGGATTAAGTGGCGATACCCAGCTGAAAATA
TCA
TTTCCAGAAGTTGTCAAATCTTACGATGTTATTATCAGCACTGCTCAAATCCTTGAAAACTCCCTCT
TA
AATCTGGAGAGTGGAGACGATGACGGTGTGCAGCTGTCAGACTTCTCTCTCATTATCATTGATGAGTG
C
CATCACACCAACAAGGAGGCAGTCTATAACAACATCATGAGACGATATTTGAAGCAGAAGCTGAGAAAC
AAT
GACCTCAAGAAACAAAACAAACCAGCCATTCCCCTGCCGCAGATACTAGGACTGACAGCTTCACCTG
GT
GTTGGAGCAGCCAAAAAGCAGTCTGAGGCTGAAAAACATATTTTAAATATATGTGCCAATCTTGATGC
C
TTTACCATTAAAACAGTGAAAGAGAATCTTGGTCAACTCAAACACCAAATAAAGGAACCATGCAAGAAA
TTT
GTGATTGCTGATGACACCAGAGAAAATCCATTTAAAGAGAAACTTCTAGAAATTATGGCAAGCATTC
AG
ACTTACTGCCAAAAAAGTCCAATGTCAGATTTTGGAACCCAACATTATGAGCAGTGGGCCATTCAAAT
G
GAGAAAAAAGCTGCTAAAGACGGAAATCGCAAAGATCGCGTCTGTGCAGAACATTTGAGGAAGTACAAC
GAA
GCCCTACAAATCAACGACACGATCCGAATGATTGATGCATATAGCCACCTGGAGACATTCTACACTG
AT
GAGAAAGAAAAGAAGTTCGCAGTCCTCAATGACAGCGACAAGAGTGATGACGAGGCCAGCAGTTGCAA
T
GACCAACTTAAGGGCGATGTAAAGAAATCTTTGAAACTGGACGAAACGGATGAATTTCTCATGAATTTG
TTC
TTTGATAACAAGAAAATGTTGAAAAAACTAGCTGAAAACCCAAAATACGAGAATGAAAAACTCATTA
AA
TTAAGAAACACGATACTGGAACAATTCACAAGGTCTGAGGAGTCCTCCCGAGGAATTATTTTTACAAA
A
ACACGACAGAGCACCTACGCACTTTCCCAGTGGATCATGGAAAATGCAAAGTTTGCGGAAGTTGGAGTC
AAA
GCGCATCACCTGATTGGCGCGGGGCACAGCAGTGAAGTCAAGCCCATGACTCAGACTGAACAAAAAG
AA
GTCATTAGTAAATTTCGCACTGGCGAAATAAATCTGCTTATCGCTACGACGGTGGCAGAGGAAGGCCT
G
GATATCAAAGAGTGCAATATTGTTATTCGTTATGGCCTTGTCACGAACGAGATAGCCATGGTCCAGGCC
CGG
GGTCGAGCCAGAGCTGATGAAAGCACGTATGTCCTGGTCACCAGCAGTGGCTCAGGAGTTACCGAAC
GG
GAGATTGTTAATGATTTCCGAGAGAAGATGATGTATAAAGCTATTAACCGTGTTCAAAACATGAAACC
A
GAGGAGTATGCACATAAGATTTTGGAATTGCAGGTGCAAAGTATCCTGGAAAAGAAAATGAAAGTCAAA
AGA
AGCATTGCAAAGCAATACAACGACAATCCATCGTTAATAACACTTCTCTGCAAAAATTGTAGCATGC
TG
GTCTGCTCGGGAGAAAACATCCATGTCATTGAGAAGATGCATCATGTCAATATGACACCAGAATTCAA
G
GGACTCTACATTGTAAGAGAAAACAAAGCACTGCAAAAGAAATTTGCTGATTATCAGACCAATGGAGAG
ATT
ATCTGCAAGTGTGGCCAGGCTTGGGGAACAATGATGGTGCACAAAGGTTTAGATTTGCCTTGTCTTA
AA
ATAAGGAATTTTGTAGTCAATTTCAAAAATAACTCACCGAAGAAACAGTACAAGAAGTGGGTGGAATT
G
CCTATCAGATTTCCTGATCTTGACTACTCAGAATACTGCTTGTATAGTGATGAAGATTAG


Translation (976 aa):
MSIVCSAEDSFRNLILFFRPRLKMYIQVEPVLDHLIFLSAETKEQILKKINTCGNTSAAELLLSTLEQGQ
W
PLGWTQMFVEALEHSGNPLAARYVKPTLTDLPSPSSETAHDECLHLLTLLQPTLVDKLLINDVLDTCFE
K
GLLTVEDRNR
ISAAGNSGNESGVRELLRRIVQKENWFSTFLDVLRQTGNDALFQELTGGGCPEDNTESD
T
SLAEGSVSCFDESLGHNSNMGRDSGTMGSDS
DESVIQTKRVSPEPELQLRPYQMEVAQPALDGKNIIIC
L
PTGSGKTRVAVYITKDHLDKKKQASESGKVIVLVNK
VMLAEQLFRKEFNPYLKKWYRIIGLSGDTQLKI
S
FPEVVKSYDVIISTAQILENSLLNLESGDDDGVQLS
DFSLIIIDECHHTNKEAVYNNIMRRYLKQKLRN
N
DLKKQNKPAIPLPQILGLTASPGVGAAKKQSEAEKHILN
ICANLDAFTIKTVKENLGQLKHQIKEPCKK
F
VIADDTRE
NPFKEKLLEIMASIQTYCQKSPMSDFGTQHYEQWAIQMEKKAAKDGNRKDRVCAEHLRKYN
E
ALQINDTIRMIDAYSHLETFYTDEKEKKFAVLNDSDKSDDEASSCNDQLKGDVKKSLKLDETDEFLMNL
F
F
DNKKMLKKLAENPKYENEKLIKLRNTILEQFTRSEESSRGIIFTKTRQSTYALSQWIMENAKFAEVGV
K
AHHLIGAGHSSEVKPMTQ
TEQKEVISKFRTGEINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQA
R
GRARADESTYVLVTSSGSGVTEREIVNDFREKMMYKAINRVQNMKPEEYAHK
ILELQVQSILEKKMKVK
R
SIAKQYNDNPSLITLLCKNCSMLVCSGENIHVIEKMHHVNMTPEF
KGLYIVRENKALQKKFADYQTNGE
I
ICKCGQ
AWGTMMVHKGLDLPCLKIRNFVVNFKNNSPKKQYKKWVELPIRFPDLDYSEYCLYSDED



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser