NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS39416.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39416.1 Public Mus musculus 6 Calcr 16 104 75 CCDS HistoryNCBI Gene:12311Re-query CCDS DB by CCDS ID:39416.1Re-query CCDS DB by GeneID:12311See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 39416.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000115622 ENSMUSP00000111285 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115622Link to Ensembl Protein Viewer:ENSMUSP00000111285Re-query CCDS DB by Nucleotide ID:ENSMUST00000115622Re-query CCDS DB by Protein ID:ENSMUSP00000111285
Original member Current member EBI,WTSI ENSMUST00000171613 ENSMUSP00000130083 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000171613Link to Ensembl Protein Viewer:ENSMUSP00000130083Re-query CCDS DB by Nucleotide ID:ENSMUST00000171613Re-query CCDS DB by Protein ID:ENSMUSP00000130083
Original member Current member EBI,WTSI ENSMUST00000168592 ENSMUSP00000130243 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000168592Link to Ensembl Protein Viewer:ENSMUSP00000130243Re-query CCDS DB by Nucleotide ID:ENSMUST00000168592Re-query CCDS DB by Protein ID:ENSMUSP00000130243
Original member Current member EBI,WTSI OTTMUST00000091182 OTTMUSP00000050188 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000091182Link to Vega Protein Viewer:OTTMUSP00000050188Re-query CCDS DB by Nucleotide ID:OTTMUST00000091182Re-query CCDS DB by Protein ID:OTTMUSP00000050188
Original member Current member EBI,WTSI OTTMUST00000091196 OTTMUSP00000050201 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000091196Link to Vega Protein Viewer:OTTMUSP00000050201Re-query CCDS DB by Nucleotide ID:OTTMUST00000091196Re-query CCDS DB by Protein ID:OTTMUSP00000050201
Original member Current member NCBI NM_001042725.1 NP_001036190.1 Accepted alive Link to Nucleotide Sequence:NM_001042725.1Link to Protein Sequence:NP_001036190.1Re-query CCDS DB by Nucleotide ID:NM_001042725Re-query CCDS DB by Protein ID:NP_001036190Link to BLink:NP_001036190.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001036190.1 496 Q60755-2 496 100% 0 0

Chromosomal Locations for CCDS 39416.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 3687395 3687643 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3691532 3691573 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3692542 3692760 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3693701 3693767 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3693849 3693909 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3700127 3700280 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3708486 3708612 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3711448 3711539 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3714649 3714761 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3717092 3717202 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3718565 3718718 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3722923 3723001 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3752952 3752974 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1491 nt):
ATGACTCCAAGGAGGTCCAGAGTGAAAAGGCGGAATCTCCGCAAACCGAAGATGAGGTTCCTTCTCGTGA
AC
AGGTTCACCCTGCTGCTCCTGCTCCTAGTGAGCCCAACTCCAGTTCTTCAGGCTCCTACCAATCTCAC
T
GACTCCGGCCTTGATCAGGAGCCATTCCTGTACTTGGTTGGCCGCAAGAAGCTGCTGGATGCTCAGTAC
AAA
TGCTATGACCGGATTCATCAGTTGCCCTCTTATGAAGGAGAAGGTCTGTACTGCAACCGCACCTGGG
AT
GGCTGGATGTGCTGGGACGACACTCCCGCTGGAGCCACAGCCTATCAGCACTGCCCTGACTACTTCCC
G
GACTTTGACACAGCAGAAAAGGTTTCAAAATACTGTGATGAAAATGGAGAGTGGTTTAGACACCCTGAC
AGC
AACCGAACCTGGTCCAACTATACTCTGTGCAACGCTTTCACTTCTGAGAAACTGCAAAATGCGTACG
TT
CTTTATTACCTGGCTCTTGTGGGTCACTCCTTGTCGATTGCTGCTTTGGTTGCTTCCATGCTGATCTT
C
TGGATTTTCAAGAACCTTAGCTGCCAGAGGGTGACCTTGCACAAGCACATGTTCCTTACTTATATTCTG
AAT
TCTATCATTATCATCATCCACCTGGTTGAGGTTGTGCCCAATGGAGATCTGGTGCGGCGGGATCCTA
TA
AGTTGCAAGGTTCTACACTTTTTACATCAGTACATGATGTCTTGCAACTACTTCTGGATGCTCTGCGA
G
GGGATCTATCTTCATACTCTGATTGTCATGGCTGTGTTTACCGACGAGCAACGCCTACGCTGGTACTAT
CTT
CTTGGCTGGGGGTTCCCGATAGTGCCAACCATTATCCACGCCATCACTCGTGCCCTCTACTACAACG
AC
AACTGCTGGCTGAGTGCAGAAACCCACTTGCTTTACATCATCCATGGACCCGTCATGGTGGCTCTGGT
G
GTCAACTTCTTCTTTCTTCTCAACATTGTCCGCGTGCTTGTGACCAAGATGAGGCAAACCCACGAGGCC
GAG
TCCTACATGTACCTGAAGGCTGTGAAGGCCACCATGGTCCTTGTGCCCCTGCTGGGGATCCAGTTTG
TT
GTGTTTCCCTGGAGGCCCTCCAACAAGGTGCTTGGGAAGATCTATGATTATCTCATGCACTCTCTGAT
T
CATTTCCAGGGATTCTTTGTGGCGACTATCTACTGCTTCTGCAACCATGAGGTGCAAGTCACCCTGAAG
CGC
CAGTGGACGCAGTTCAAGATCCAGTGGAGCCAACGCTGGGGAAGGCGCCGCCGCCCCACCAACCGCG
TA
GTTAGTGCTCCTCGGGCTGTAGCCTTCGCTGAGCCAGATGGCCTCCCCATTTACATCTGCCATCAGGA
A
CCACGGAATCCTCCAATCAGCAACAACGAAGGCGAGGAGAGTACTGAAATGATCCCCATGAACGTCATC
CAG
CAAGACGCATCCGCTTGA


Translation (496 aa):
MTPRRSRVKRRNLRKPKMRFLLVNRFTLLLLLLVSPTPVLQAPTNLTDSGLDQEPFLYLVGRKKLLDAQY
K
CYDRIHQLPSYEGE
GLYCNRTWDGWMCWDDTPAGATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPD
S
NRTWSNYTLCNAFTSEKLQ
NAYVLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYIL
N
SIIIIIHLVEVVPNGDLVRRDP
ISCKVLHFLHQYMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWYY
L
LGW
GFPIVPTIIHAITRALYYNDNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVLVTKMRQTHEA
E
SYMYLKAVKATMVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHFQ
GFFVATIYCFCNHEVQVTLK
R
QWTQFKIQWSQRWGRRRRPTNRVVSAPRAVAFAEPDGLPIYICHQEPRNPPISNNEGEESTEMIPMNVI
Q
QDASA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser