NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS57346.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57346.1 Public Mus musculus 5 Apbb2 16 104 75 CCDS HistoryNCBI Gene:11787Re-query CCDS DB by CCDS ID:57346.1Re-query CCDS DB by GeneID:11787

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Sequence IDs included in CCDS 57346.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000159512 ENSMUSP00000124807 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000159512Link to Ensembl Protein Viewer:ENSMUSP00000124807Re-query CCDS DB by Nucleotide ID:ENSMUST00000159512Re-query CCDS DB by Protein ID:ENSMUSP00000124807
Original member Current member EBI,WTSI OTTMUST00000082405 OTTMUSP00000044165 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000082405Link to Vega Protein Viewer:OTTMUSP00000044165Re-query CCDS DB by Nucleotide ID:OTTMUST00000082405Re-query CCDS DB by Protein ID:OTTMUSP00000044165
Original member Current member NCBI NM_001201414.1 NP_001188343.1 Accepted alive Link to Nucleotide Sequence:NM_001201414.1Link to Protein Sequence:NP_001188343.1Re-query CCDS DB by Nucleotide ID:NM_001201414Re-query CCDS DB by Protein ID:NP_001188343Link to BLink:NP_001188343.1

Chromosomal Locations for CCDS 57346.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

Chromosome Start Stop Links
5 66302542 66302709 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66307535 66307714 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66309078 66309193 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66311000 66311083 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66312159 66312246 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66313315 66313429 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66362718 66362845 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66364974 66365120 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66391627 66391687 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66391772 66391857 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66400076 66400284 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66451468 66452283 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66462098 66462116 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2217 nt):
ATGTCAGAAGTACTTCCAGCTGACTCAGGTGTTGGCACCTTGGCAGTGTTTATGGCCAGCAGCGGATCCA
CA
GACATTGCAAACCGGAACAGCCCAGCCACACCACCAAATACCCTCAATCTCCGTTCCTCCCACAATGA
A
CTATTAAATGCAGAGATCAAACACTCAGATGCCAAGAACAGCACGCCCCCCAAATGCAGGAAAAAATAT
GCA
CTGACTAATATTCAGGCGGCCATGGGCCTCTCGGATCCAGCTGTACAGCCCCTGCTGGGAAACGGCT
CT
GCCAACATCAAGCTGGTTAAAAATGGGGAGAACCAGCTCCGCAAGGCTGCAGAACAGGGGCAGCAGGA
C
CCCAACAAGAACCTCAGCCCTGCAGCCGTCATCAACCTAACCTCCGAGAAGCTGGAGGTTAAAGATCCC
CAC
CCACAGGAGTCTTCAGGCTGTGAGATTTTGCCCTCCCAGCCCAGGAGAACTAAGAGCTTCCTCAATT
AC
TATGCAGACCTGGAAACCTCGGCTAGAGAGCTAGGGCAGAACCTGGGCCCCTGCCAAGGGGTTGGAGA
G
GAGAAAGCCCAGCCTGGCCCAGGCCAGGCCCCAGTAGTCATTGGGAATGGTGACTTGCTGCCACAGAAA
CCA
AACAAACCCCAATCCAGCCCAGAGGATGGCCAAGTAGCCACAGTATCGTCCAGCCCAGAGACCAAGA
AA
GACCACCCTAAAACAGGAGCCAAAACCGACTGTGCCCTCCATCGGATCCAGAACCTGGCACCAAGTGA
C
GAGGAATCCAGCTGGACGACGCTGTCCCAAGACAGTGCCTCCCCCAGCTCCCCAGATGAAACAGCAGAT
ATC
TGGAGTGATCACTCATTTCAGACAGATCCCGATTTGCCGCCGGGCTGGAAGAGAGTCAATGACATTG
CC
GGGACCTATTACTGGCACATCCCAACAGGGACGACTCAATGGGAACGGCCTGTCTCCATCCCAGCAGA
T
CTCCACGGCTCTAGGAAAGGGTCACTTAGTTCTGTAACGCCATCGCCCACCCCAGAGAATGAGGATTTG
CAC
GCAGCCACAGTTAACCCAGACCCCAGTTTAAAAGAGTTTGAAGGAGCAACGCTACGCTATGCATCCT
TG
AAACTCAGAAACGCCCCTCATGGTGATGACGATGATTCTTGTAGTATCAACAGTGACCCAGAAGCCAA
G
TGTTTTGCTGTGCGTTCTCTGGGCTGGGTAGAGATGGCCGAGGAGGACCTTGCCCCCGGGAAGAGCAGT
GTC
GCTGTCAACAACTGCATCCGACAGCTTTCCTACTGCAAAAACGACATCCGGGACACAGTCGGCATCT
GG
GGAGAGGGCAAAGACATGTACCTGAGCCTGGAAAACGACATGCTCAGCCTGGTGGACCCCATGGACCG
C
TCCGTGTTACACTCCCAGCCCATCGTGAACATCCGAGTGTGGGGCGTGGGCCGAGACAACGGCCGGGAC
TTT
GCTTACGTGGCGAGAGACAAGGACACAAGGATTCTGAAATGCCATGTGTTTCGATGTGACACACCAG
CA
AAAGCCATTGCCACAAGTCTCCACGAAATCTGCTCCAAGATTATGGCTGAACGGAAGAACGCCAAAGC
A
CTGGCCTGCAGCTCCTTACAGGAGAGGACCAATATGAGTCTCGATGTCCCTTTGCAAGTAGATTTTCCA
ACA
CCAAAGACGGAGCTGGTGCAGAAGTTCCGCGTGCAGTACCTGGGCATGTTACCTGTAGACAGACCTG
TC
GGCATGGACACCCTGAACAGTGCCATAGAAAATCTCATGACGTCATCCAGCAAGGAGGACTGGCCTTC
G
GTGAACATGAACGTGGCCGACGCCACTGTGACTGTCATCAGTGAAAAGAATGAAGAGGAGGTCTTGGTG
GAG
TGTCGAGTGCGGTTCCTGTCCTTCATGGGTGTCGGGAAGGATGTCCACACATTCGCCTTCATCATGG
AC
ACTGGGAACCAGCGCTTTGAGTGCCATGTGTTCTGGTGTGAGCCTAACGCAGCCAATGTGTCAGAAGC
T
GTCCAGGCTGCCTGCATGTTGCGGTATCAGAAGTGCTTGGTTGCCAGGCCACCTTCGCAGAAAGTCCGG
CCC
CCGCCCCCGCCAGCAGATTCAGTGACCCGAAGAGTCACGACCAATGTGAAACGAGGGGTCTTATCCC
TC
ATTGACACTTTGAAACAGAAGCGGCCGGTCACAGAGACTCCCTAG


Translation (738 aa):
MSEVLPADSGVGTLAVFMASSGSTDIANRNSPATPPNTLNLRSSHNELLNAEIKHSDAKNSTPPKCRKKY
A
LTNIQAAMGLSDPAVQPLLGNGSANIKLVKNGENQLRKAAEQGQQDPNKNLSPAAVINLTSEKLEVKDP
H
PQESSGCEILPSQPRRTKSFLNYYADLETSARELGQNLGPCQGVGEEKAQPGPGQAPVVIGNGDLLPQK
P
NKPQSSPEDGQVATVSSSPETKKDHPKTGAKTDCALHRIQNLAPSDEESSWTTLSQDSASPSSPDET
AD
I
WSDHSFQTDPDLPPGWKRVNDIAGTYYWHIPTGTTQWERPVSIPADLHGSRKGSLSSVTPSPTPENE
DL
H
AATVNPDPSLKEFEGATLRYASLKL
RNAPHGDDDDSCSINSDPEAKCFAVRSLGWVEMAEEDLAPGKSS
V
AVNNCIRQLSYCKNDIRDTVGIWGE
GKDMYLSLENDMLSLVDPMDRSVLHSQPIVNIRVWGVGRDNGRD
F
AYVARDKDTRILKCHVFRCDTPAKAIATSLHEICSK
IMAERKNAKALACSSLQERTNMSLDVPLQVDFP
T
PKTELVQKFRVQYLGMLPVDRPV
GMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLV
E
CRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAACM
LRYQKCLVARPPSQKVR
P
PPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTETP




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser