NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21217.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21217.1 Public Mus musculus 7 Il4i1 16 104 75 CCDS HistoryNCBI Gene:14204Re-query CCDS DB by CCDS ID:21217.1Re-query CCDS DB by GeneID:14204See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 21217.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033015 ENSMUSP00000033015 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033015Link to Ensembl Protein Viewer:ENSMUSP00000033015Re-query CCDS DB by Nucleotide ID:ENSMUST00000033015Re-query CCDS DB by Protein ID:ENSMUSP00000033015
Original member Current member EBI,WTSI OTTMUST00000073030 OTTMUSP00000037752 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000073030Link to Vega Protein Viewer:OTTMUSP00000037752Re-query CCDS DB by Nucleotide ID:OTTMUST00000073030Re-query CCDS DB by Protein ID:OTTMUSP00000037752
Original member Current member NCBI NM_010215.3 NP_034345.2 Accepted alive Link to Nucleotide Sequence:NM_010215.3Link to Protein Sequence:NP_034345.2Re-query CCDS DB by Nucleotide ID:NM_010215Re-query CCDS DB by Protein ID:NP_034345Link to BLink:NP_034345.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034345.2 630 O09046-1 630 99.8413% 0 1

Chromosomal Locations for CCDS 21217.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 44836525 44836537 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44836631 44836866 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44837376 44837488 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44837989 44838190 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44839151 44839219 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44839324 44839460 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44839583 44840705 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1893 nt):
ATGGCTGGGCTGGCCCTGCGTCTTGTCCTGGCGGCCACCCTCCTTGGTCTGGCAGGCTCTCTGGACTGGA
AG
GCAGCCTCCAGCTTGAACCCTATTGAGAAGTGTATGGAGGACCACGATTATGAGCAGCTACTCAAGGT
G
GTGACCTTGGGCCTCAATCGGACTTCGAAGCCCCAGAAGGTGGTAGTGGTTGGTGCAGGCGTGGCAGGG
CTG
GTAGCAGCCAAGATGCTCAGTGATGCAGGACACAAGGTCACCATCCTGGAGGCAGATAACAGGATTG
GG
GGCCGTATCTTCACTTTCCGGGATGAGAAGACAGGCTGGATAGGGGAGCTTGGGGCCATGCGAATGCC
C
AGCTCTCACAGGATCTTGCACAAGCTCTGCAGGACCCTGGGCCTCAACCTGACTCAGTTCACACAGTAT
GAT
GAGAACACGTGGACGGAGGTGCATAATGTGAAGCTGCGAAACTATGTGGTGGAGAAGATGCCAGAAA
AG
CTGGGCTACAACCTGAACAACAGGGAAAGGGGCCATTCCCCAGAGGACATCTACCAGATGGCACTCAA
C
AAGGCCTTCAAAGACCTCAAGGCCTTGGGCTGCAAGAAAGCCATGAATAAGTTCAACAAGCATACGCTT
CTG
GAATACCTCCTCGAGGAGGGCAACCTGTCCCGGCCGGCTGTGCAGCTCCTGGGAGATGTGATGTCCG
AG
GAGGGCTTCTTCTACCTCAGCTTTGCAGAAGCCTTACGTGCGCACGCCTGCCTGAGCGATAGACTCCG
G
TACAGCCGCATCGTAGGTGGCTGGGACCTGCTTCCGCGAGCTCTGCTGAGCTCACTGTCCGGGGCGCTG
CTA
CTGAACGCGCCTGTGGTGTCGATCACTCAGGGGAGGAACGATGTGCGCGTGCACATTGCCACCTCGC
TT
CACAGCGAGAAGACGCTGACAGCCGACGTGGTGCTGCTGACTGCCAGTGGACCCGCGCTGCAGCGCAT
T
ACCTTCTCGCCGCCCTTGACTCGCAAGAGGCAGGAGGCACTGCGCGCGCTTCACTACGTAGCAGCCAGC
AAG
GTTTTTCTGAGTTTCCGTCGGCCCTTCTGGCACGAGGAGCACATCGAGGGCGGCCACTCCAACACTG
AC
CGCCCATCGCGCCTCATATTCTATCCCGCGCAGGGCGAGGGCTCACTGCTTCTGGCCTCCTACACGTG
G
TCGGACGCTGCAGCCCCCTTCGCTGGACTGAGCACCGACCAGACCCTGCGTTTGGTGCTCCAGGACGTG
GCG
GCCCTGCACGGGCCTGTGGTGTTCCGGCTGTGGGACGGCAGGGGTGTGGTCAAGCGCTGGGCAGAGG
AC
CCGCATAGCCAGGGAGGCTTCGTGGTGCAGCCGCCATTGTACGGGCGCGAGGCTGAGGACTATGACTG
G
TCAGCCCCCTTCGGCCGCATTTACTTCGCGGGCGAGCACACAGCTCTCCCGCATGGCTGGGTAGAGACC
GCT
GTCAAGTCCGGGTTGCGGGCCGCGGTGAGAATCAATAATAACTATGGGTACGGGGAGGTCGACCCCC
AG
ATGATGGAGCATGCATATGCAGAGGCCAACTATCTGGACCAGTATCCTGAAGGGGAGAGGCCCGAGGA
G
CAGCAGGCGCGGGAAGAAGTCAGCCCAGATGAACAGGAGCCCTCTCACAAACACTTGTTGGTGGAAACG
AGC
CCCGAGGGGCAGCAACACGCGTTTGTGGAGGCCATTCCCGAGCTGCAGGGACACGTGTTCGTGGAGA
CT
GTCCCCCAGGAGAAGGGGCACGCCCACCAGAATATATATCCTTCGGAGCATGTACAGGTGCATGGGGA
A
GTCATCCCTGAGTGGCATGGTCATGGGGGATCTGGCACCCCGCAAATGCACCGAGTGGGGGACCACTCC
TAA


Translation (630 aa):
MAGLALRLVLAATLLGLAGSLDWKAASSLNPIEKCMEDHDYEQLLKVVTLGLNRTSKPQKVVVVGAGVAG
L
VAAKMLSDAGHK
VTILEADNRIGGRIFTFRDEKTGWIGELGAMRMPSSHRILHKLCRTLGLNLTQFTQY
D
ENTWTEVHNVKLRNYVVEKMPEKLGYNLNNRERGHSPEDIYQMALNK
AFKDLKALGCKKAMNKFNKHTL
L
EYLLEEGNLSRPAVQLLGDVMSEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSLSGAL
L
LNAPVVSITQGRNDVRVHIATSLHSEKTLTADVVLLTASGPALQRITFSPPLTRKRQEALRALHYVAAS
K
VFLSFRRPFWHEEHIEGGHSNTDRPSRLIFYPAQGEGSLLLASYTWSDAAAPFAGLSTDQTLRLVLQDV
A
ALHGPVVFRLWDGRGVVKRWAEDPHSQGGFVVQPPLYGREAEDYDWSAPFGRIYFAGEHTALPHGWVET
A
VKSGLRAAVRINNNYGYGEVDPQMMEHAYAEANYLDQYPEGERPEEQQAREEVSPDEQEPSHKHLLVET
S
PEGQQHAFVEAIPELQGHVFVETVPQEKGHAHQNIYPSEHVQVHGEVIPEWHGHGGSGTPQMHRVGDHS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser