NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36565.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36565.1 Public Mus musculus 12 Klc1 16 104 75 CCDS HistoryNCBI Gene:16593Re-query CCDS DB by CCDS ID:36565.1Re-query CCDS DB by GeneID:16593See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 36565.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000084941 ENSMUSP00000082004 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000084941Link to Ensembl Protein Viewer:ENSMUSP00000082004Re-query CCDS DB by Nucleotide ID:ENSMUST00000084941Re-query CCDS DB by Protein ID:ENSMUSP00000082004
Original member Current member EBI,WTSI OTTMUST00000068082 OTTMUSP00000034356 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000068082Link to Vega Protein Viewer:OTTMUSP00000034356Re-query CCDS DB by Nucleotide ID:OTTMUST00000068082Re-query CCDS DB by Protein ID:OTTMUSP00000034356
Original member Current member NCBI NM_001025360.2 NP_001020531.2 Accepted alive Link to Nucleotide Sequence:NM_001025360.2Link to Protein Sequence:NP_001020531.2Re-query CCDS DB by Nucleotide ID:NM_001025360Re-query CCDS DB by Protein ID:NP_001020531Link to BLink:NP_001020531.2

Chromosomal Locations for CCDS 36565.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 111772320 111772580 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 111774353 111774583 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 111775924 111776002 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 111776812 111777037 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 111778020 111778107 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 111778599 111778700 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 111781652 111781825 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 111781944 111782043 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 111785272 111785321 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 111785435 111785502 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 111787488 111787596 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 111789325 111789486 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 111795548 111795678 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 111806008 111806074 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 111806315 111806317 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1851 nt):
ATGTATGACAACATGTCCACCATGGTGTACATAAAGGAAGAGAAGCTGGAGAAGCTCACGCAGGATGAGA
TC
ATCTCTAAGACCAAGCAAGTGATCCAGGGGCTGGAAGCCCTGAAGAATGAGCACAACTCCATCCTGCA
G
AGTTTGCTGGAGACGCTGAAGTGCTTGAAGAAGGATGACGAGAGCAACCTGGTGGAAGAGAAATCCAGC
ATG
ATCCGCAAGTCCCTGGAGATGCTGGAGCTTGGCCTGAGCGAGGCGCAGGTGATGATGGCGCTGTCCA
AT
CACCTGAATGCTGTGGAGTCCGAGAAGCAAAAGCTCCGCGCTCAGGTTCGACGGCTGTGCCAGGAGAA
C
CAGTGGCTGCGGGATGAGCTGGCCAACACGCAGCAGAAGTTGCAGAAGAGCGAGCAGTCGGTGGCGCAG
CTG
GAGGAGGAGAAGAAACACCTGGAGTTCATGAACCAGCTGAAGAAGTACGACGACGACATCTCCCCCT
CG
GAGGACAAAGACTCTGATTCTTCCAAAGAGCCGTTGGATGATCTCTTCCCAAATGACGAGGACGAACC
A
GGACAAGGAATCCAGCAGCAGCACAGTAGTGCTGCGGCCGCCGCCCAGCAGGGCGGCTACGAGATCCCT
GCA
AGGCTGCGCACGCTCCACAACTTGGTGATCCAGTATGCTTCACAGGGGCGTTACGAGGTGGCGGTGC
CA
CTCTGCAAGCAGGCCCTGGAGGATCTGGAGAAGACTTCCGGCCACGACCACCCCGATGTGGCTACCAT
G
CTCAACATCTTGGCCCTGGTGTACAGGGATCAGAACAAGTATAAAGATGCAGCTAACCTCCTGAACGAC
GCC
CTGGCTATCCGCGAGAAAACCCTGGGCAGAGATCACCCCGCGGTGGCAGCGACTCTGAACAACCTAG
CA
GTACTGTACGGTAAGCGAGGGAAGTACAAGGAGGCGGAGCCGCTGTGTAAACGAGCCCTGGAGATCAG
G
GAGAAGGTTCTGGGAAAGGATCATCCTGATGTTGCCAAACAGTTAAATAACCTGGCCCTGCTGTGCCAG
AAC
CAGGGCAAGTACGAGGAGGTGGAGTATTATTACCAGAGGGCCCTGGGCATCTACCAGACGAAGCTGG
GG
CCCGACGATCCCAACGTGGCCAAGACCAAGAACAACCTGGCCTCCTGTTATCTGAAACAAGGGAAGTT
C
AAGCAGGCAGAAACGCTGTACAAGGAGATTCTCACCCGCGCACACGAGCGGGAGTTTGGATCTGTGGAC
G
AC
GAGAACAAGCCCATCTGGATGCACGCTGAAGAGAGAGAGGAGTGCAAAGGCAAGCAGAAGGACGGGT
CG
GCTTTTGGAGAGTATGGCGGCTGGTATAAAGCCTGCAAAGTGGACAGTCCCACCGTCACAACCACCTT
G
AAAAACCTTGGAGCACTTTACCGACGGCAGGGGAAGTTTGAAGCTGCAGAGACATTGGAAGAAGCCGCC
ATG
AGGTCACGTAAGCAGGGTCTTGACAATGTTCACAAACAGAGAGTGGCTGAAGTGCTAAATGACCCTG
AG
AGCATGGAGAAGCGGAGGAGCCGGGAGAGTCTCAATATGGACGTGGTCAAGTACGAGAGTGGCCCTGA
C
GGAGGGGAGGAAGTGAGTATGAGCGTAGAGTGGAATGGGGATGGCACTGGATCTTTAAAGCGCAGTGGC
TCC
TTTAGCAAACTCCGGGCTTCCATTAGACGCAGCAGTGAGAAGCTGGTTAGGAAGCTGAAGGGAGGAA
GC
TCACGGGACAGTGAGCCGAGGAACCCTGGGGCATCCCCCGCAGAGCCTCTTTGTGTGGAAAACGACAG
C
AGCAGCCTAGAAGACGCTAGCACTAACTGA


Translation (616 aa):
MYDNMSTMVYIKEEKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSS
M
IRKSLEMLELGLSEAQ
VMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQ
L
EEEKKHLEFMNQLKKYDDDISPS
EDKDSDSSKEPLDDLFPNDEDEPGQGIQQQHSSAAAAAQQGGYEIP
A
RLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVY
RDQNKYKDAANLLND
A
LAIREKTLGRDHPA
VAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQ
N
QGKYEEVEYYYQRALGIYQTKLGPDDPNVAKTKNNL
ASCYLKQGKFKQAETLYKEILTRAHEREFGSVD
D
ENKPIWMHAEEREECKGKQKDGSAFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAA
M
RSRKQ
GLDNVHKQRVAEVLNDPESMEKRRSRESLNMDVVKYESGPDGGEEVSMSVEWNGDGTGSLKRSG
S
FSKLRASIRRSSEKLVRKLKGGSSRDSEPRNP
GASPAEPLCVENDSSSLEDASTN



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser