NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS39717.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39717.1 Public Mus musculus 6 Pthlh 16 104 75 CCDS HistoryNCBI Gene:19227Re-query CCDS DB by CCDS ID:39717.1Re-query CCDS DB by GeneID:19227

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 39717.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000052296 ENSMUSP00000051433 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000052296Link to Ensembl Protein Viewer:ENSMUSP00000051433Re-query CCDS DB by Nucleotide ID:ENSMUST00000052296Re-query CCDS DB by Protein ID:ENSMUSP00000051433
Original member Current member EBI,WTSI OTTMUST00000064342 OTTMUSP00000031937 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000064342Link to Vega Protein Viewer:OTTMUSP00000031937Re-query CCDS DB by Nucleotide ID:OTTMUST00000064342Re-query CCDS DB by Protein ID:OTTMUSP00000031937
Original member Current member NCBI NM_008970.3 NP_032996.2 Accepted alive Link to Nucleotide Sequence:NM_008970.3Link to Protein Sequence:NP_032996.2Re-query CCDS DB by Nucleotide ID:NM_008970Re-query CCDS DB by Protein ID:NP_032996Link to BLink:NP_032996.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032996.2 175 P22858 175 99.4286% 0 1

Chromosomal Locations for CCDS 39717.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

Chromosome Start Stop Links
6 147252568 147252577 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 147256943 147257359 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 147263270 147263370 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (528 nt):
ATGCTGCGGAGGCTGGTTCAGCAGTGGAGTGTCCTGGTATTCCTGCTCAGCTACTCCGTGCCCTCCCGCG
GG
CGTTCGGTGGAGGGGCTTGGCCGCAGGCTCAAACGCGCTGTGTCTGAACATCAGCTACTGCATGACAA
G
GGCAAGTCCATCCAAGACTTGCGCCGCCGTTTCTTCCTCCACCATCTGATCGCGGAGATCCACACAGCC
GAA
ATCAGAGCTACCTCGGAGGTGTCCCCCAACTCCAAACCTGCTCCCAACACCAAAAACCACCCCGTGC
GG
TTTGGGTCAGACGATGAGGGCAGATACCTAACTCAGGAAACCAACAAGGTGGAGACGTACAAAGAACA
G
CCACTCAAGACACCCGGGAAGAAGAAGAAAGGCAAGCCTGGGAAACGCAGAGAACAGGAGAAAAAGAAG
CGA
AGGACTCGGTCTGCCTGGCCAAGCACAGCTGCGAGTGGCCTGCTTGAGGACCCCCTGCCCCACACCT
CC
AGGCCCTCGCTGGAGCCCAGCTTAAGGACGCATTGA


Translation (175 aa):
MLRRLVQQWSVLVFLLSYSVPSRGRSVEGLGRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA
E
IRATSEVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRREQEKKK
R
RTRSAWPSTAASGLLEDPLPHTSRPSLEPSL
RTH



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser