NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS50963.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50963.1 Public Mus musculus 3 Adar 16 104 75 CCDS HistoryNCBI Gene:56417Re-query CCDS DB by CCDS ID:50963.1Re-query CCDS DB by GeneID:56417See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 50963.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000107405 ENSMUSP00000103028 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107405Link to Ensembl Protein Viewer:ENSMUSP00000103028Re-query CCDS DB by Nucleotide ID:ENSMUST00000107405Re-query CCDS DB by Protein ID:ENSMUSP00000103028
Original member Current member EBI,WTSI OTTMUST00000048132 OTTMUSP00000021977 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000048132Link to Vega Protein Viewer:OTTMUSP00000021977Re-query CCDS DB by Nucleotide ID:OTTMUST00000048132Re-query CCDS DB by Protein ID:OTTMUSP00000021977
Original member Current member NCBI NM_001146296.1 NP_001139768.1 Accepted alive Link to Nucleotide Sequence:NM_001146296.1Link to Protein Sequence:NP_001139768.1Re-query CCDS DB by Nucleotide ID:NM_001146296Re-query CCDS DB by Protein ID:NP_001139768Link to BLink:NP_001139768.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001139768.1 1178 Q99MU3-1 1178 100% 0 0

Chromosomal Locations for CCDS 50963.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 89730811 89730838 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89734842 89736273 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89737990 89738173 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89739170 89739318 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89739833 89739971 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89740094 89740278 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89745376 89745601 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89745820 89745991 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89746565 89746658 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89747172 89747294 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89747538 89747671 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89749637 89749819 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89750236 89750348 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89750628 89750755 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89750929 89751175 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3537 nt):
ATGTCTCAAGGGTTCAGGGGACCCACAGGGGTGTTCCCTCACCAGACACAGTCGTACTTGGACCCTAGTC
AT
GAGCATAGCAAGTGGAGATACCCGCAGCCACAGGGGCCGGAGTCTTACCCTAGGAGTTTCCAGCTTCA
G
CAGATAGAGTTTCTCAAAGGGCGGCTCCCAGAAGCACCCTTGATTGGAATACAAACCCAGTCACTGCCG
CCA
TTCCTCCCAGGACACTGGCCAAGATTCCCAGGGCCACCTGCCCAAGACAGGCAACTGGAAATCTGGG
AG
TTCCCCAGGAGTGTGACTCTCAGAAATCAGGGGTTCCACATAGGACCCCCACTTCCTCCCCCACACAG
C
AGGGGTACACCATGGAGAGGTGCTGACGGGCTTTGCTCACACTTCCGGGAGCTGAGCATCAGTCAGAGT
CCG
GAGCAGAAGGTTCTAAACCGCCTGGAAGAGCTTGGGGAGGGGAAGGCCACCACTGCCCATGTGCTAG
CC
AGAGAGCTCAGAATCCCCAAAAGGGACATCAATCGTATTTTGTACTCCCTGGAAAAGAAGGGAAAGCT
G
CACAGAGGAAGGGGGAAACCTCCTTTGTGGAGCCTTGTGCCCTTGAGTCAGGCTTGGACTCAGCCCCCT
GGA
GTTGTGAATCCAGATAGTTGTATCCAGGAATTCCCTAGAGGAGAGCCTGGTTTGGACAGTGAGGACG
GA
GACCCTGCCTCTGACTTAGAAGGACCTTCTGAGCCTCTTGACATGGCTGAAATCAAGGAGAAGATCTG
T
GACTATCTGTTCAATGTGTCAAACTCCTCTGCCCTGAACCTGGCTAAGAACATTGGCCTCACCAAGGCC
CGA
GATGTGACCTCAGTGCTGATTGACTTGGAAAGGCAAGGCGATGTCTACAGGCAAGGGGCAACTCCTC
CC
ATCTGGTACTTGACGGACAAGAAGCGTGAGAGGCTGCAGATGAAGAGAAGTACACACAGTGCTCCTGC
C
CCTACCCCGACAGCTGTCCCAGAGGCCACTAGAAGCCCCTCATTCCCTGCCTGCCACCCGCCCCCAGCA
GGT
GCCTCAAGCAGTGTGGCAGCCTCCAAGAGAGTGGAGAATGGGCAGGAGCCTGCGATAAAGCATGAAA
GT
AGGCATGAGGCCAGACCAGGACCAATGAGACTGCGGCCTCACGCTTATCACAATGGCCCCTCTAGAGC
A
GGGTATGTGGCCTCTGAAAATGGCCAGTGGGCCACAGATGACATCCCAGATAACTTGAATAGTATCCAC
ACA
GCACCAGGTGAGTTTCGAGCCATCATGGAGATGCCCTCCTTCTACAGCCCTACCTTGCCACGGTGTT
CA
CCCTACAAGAAGCTAACTGAGTGCCAGCTGAAGAACCCTGTCAGCGGGTTGTTAGAGTATGCTCAGTT
C
ACTAGTCAGACCTGTGATTTCAACCTGATAGAGCAGAGTGGACCGTCCCATGAACCTCGATTTAAATTC
CAG
GTTGTCATCAATGGGCGGGAATTTCCCCCAGCTGAGGCTGGCAGCAAGAAAGTAGCCAAGCAGGACG
CA
GCAGTGAAAGCCATGGCGATTCTGCTTCGGGAAGCCAAAGCCAAAGACAGTGGTCAACCAGAAGACTT
G
TCCCACTGTCCCATGGAAGAAGACTCGGAGAAACCAGCAGAGGCTCAGGCCCCCAGCTCCTCAGCAACA
TCC
TTGTTCTCTGGGAAGAGCCCAGTTACTACACTGCTTGAGTGCATGCACAAACTAGGGAACTCCTGTG
AA
TTCCGTCTCCTGTCCAAAGAAGGCCCTGCTCATGACCCCAAGTTCCAGTACTGTGTAGCAGTAGGAGC
C
CAGACCTTCCCCCCTGTGAGCGCCCCCAGCAAGAAGGTAGCAAAGCAGATGGCCGCAGAGGAAGCCATG
AAG
GCGCTGCAGGAGGAGGCAGCCAGTTCAGCGGATGACCAGTCTGGAGGTGCGAACACAGACTCACTTG
AT
GAATCTATGGCTCCCAACAAGATCAGGAGGATTGGTGAGCTCGTCAGGTACCTGAACACCAACCCCGT
A
GGCGGCTTGTTGGAGTACGCCCGATCTCATGGCTTTGCTGCTGAGTTCAAGCTCATTGACCAGTCTGGA
CCT
CCTCACGAACCCAAGTTTGTTTACCAAGCAAAAGTTGGGGGCCGCTGGTTTCCAGCCGTGTGTGCAC
AC
AGCAAGAAACAGGGCAAGCAGGATGCAGCGGATGCAGCCCTCCGGGTCTTGATCGGGGAGAGCGAGAA
G
GCAGAGCAGTTGGGTTTCGCAGAGGTAACCCCAGTAACAGGGGCCAGTCTCAGAAGAACTATGCTCCTC
CTT
TCCAGGTCCCCAGATGCACATCCAAAGACACTTCCTCTCTCTGGCAGCACCTTCCACGACCAGATAG
CT
ATGCTGAGCCACAGGTGCTTCAATGCTCTGACCAACAGTTTCCAGCCCTCCCTGCTCGGCCGCAAGAT
C
CTGGCTGCCATTATTATGAAAAGAGATCCAGAGGACATGGGTGTTGTCGTGAGTTTGGGGACAGGCAAT
CGC
TGTGTGAAAGGGGACTCTCTCAGCCTGAAGGGAGAGACGGTCAATGACTGCCATGCCGAAATCATCT
CC
CGGAGGGGCTTCATCAGGTTTCTCTACAGTGAACTGATGAAGTACAACCACCACACTGCCAAGAACAG
C
ATATTTGAGCTTGCCAGGGGAGGAGAGAAGCTGCAGATAAAGAAGACGGTTTCTTTTCATCTCTACATC
AG
C
ACGGCGCCATGTGGAGATGGGGCCCTCTTTGACAAATCCTGCAGTGACCGTGCCGTGGAAAGCACAG
AG
TCCCGCCATTACCCTGTCTTTGAAAATCCCAAGCAAGGCAAGCTTCGCACCAAGGTGGAGAATGGGGA
A
GGCACAATTCCTGTGGAGTCCAGTGATATTGTACCCACGTGGGATGGCATCCGCCTTGGGGAAAGACTC
CGT
ACCATGTCCTGTAGTGACAAAATCCTACGCTGGAATGTGCTGGGCCTGCAAGGGGCGTTGTTGACGC
AC
TTCCTACAGCCTGTGTACCTGAAATCTGTAACCTTAGGTTACCTTTTCAGCCAAGGGCATCTGACCCG
T
GCTATTTGCTGCCGCGTGACCAGAGATGGGAAAGCATTTGAGGATGGACTACGCTATCCCTTTATTGTC
AAC
CACCCCAAGGTCGGCCGAGTCAGTGTTTATGATTCCAAAAGACAGTCCGGAAAGACCAAGGAAACAA
GC
GTCAACTGGTGCATGGCTGATGGCTATGACCTAGAGATCCTGGATGGCACCAGAGGCACTGTGGATGG
A
CCAGGGAAAGAGTTGTCTCGGGTGTCCAAGAAGAATATTTTCCTTCAGTTTAAGAAGCTCTGCTCCTTC
CGA
GCCCGCAGAGATTTACTGCAGCTCTCTTATGGTGAAGCCAAGAAAGCTGCCCGTGACTATGACTTAG
CC
AAGAACTACTTCAAGAAAAGCCTGCGAGACATGGGCTATGGGAATTGGATCAGCAAACCCCAGGAGGA
A
AAGAACTTTTACCTCTGTCCAGTACCCAATGACTGA


Translation (1178 aa):
MSQGFRGPTGVFPHQTQSYLDPSHEHSKWRYPQPQGPESYPRSFQLQQIEFLKGRLPEAPLIGIQTQSLP
P
FLPGHWPRFPGPPAQDRQLEIWEFPRSVTLRNQGFHIGPPLPPPHSRGTPWRGADGLCSHFRELSISQS
P
EQKVLNRLEELGEGKATTAHVLARELRIPKRDINRILYSLEKKGKLHRGRGKPPLWSLVPLSQAWTQPP
G
VVNPDSCIQEFPRGEPGLDSEDGDPASDLEGPSEPLDMAEIKEKICDYLFNVSNSSALNLAKNIGLTKA
R
DVTSVLIDLERQGDVYRQGATPPIWYLTDKKRERLQMKRSTHSAPAPTPTAVPEATRSPSFPACHPPPA
G
ASSSVAASKRVENGQEPAIKHESRHEARPGPMRLRPHAYHNGPSRAGYVASENGQWATDDIPDNLNSIH
T
APGEFRAIMEMPSFYSPTLPRCSPYKKLTECQLKNPVSGLLEYAQFTSQTCDFNLIEQSGPSHEP
RFKF
Q
VVINGREFPPAEAGSKKVAKQDAAVKAMAILLREAKAKDSGQPEDLSHCPMEEDSEK
PAEAQAPSSSAT
S
LFSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHDP
KFQYCVAVGAQTFPPVSAPSKKVAKQMAAEEAM
K
ALQEEAASSADDQ
SGGANTDSLDESMAPNKIRRIGELVRYLNTNPVGGLLEYARSHGFAAEFKLIDQSG
P
PHEP
KFVYQAKVGGRWFPAVCAHSKKQGKQDAADAALRVLIGESEKAEQLGFAEVTPVTGASLRRTMLL
L
SRSPDAHPKT
LPLSGSTFHDQIAMLSHRCFNALTNSFQPSLLGRKILAAIIMKRDPEDMGVVVSLGTGN
R
CVKGDSLSLKGETVNDCHAEIISRRGFI
RFLYSELMKYNHHTAKNSIFELARGGEKLQIKKTVSFHLYI
S
TAPCGDGALFDKSCSDRAVESTESRHYPVFENPKQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERL
R
TMSCSDKILRWNVLGLQGALLTHFLQPVYLKSVTL
GYLFSQGHLTRAICCRVTRDGKAFEDGLRYPFIV
N
HPK
VGRVSVYDSKRQSGKTKETSVNWCMADGYDLEILDGTRGTVDGPGKELSRVSKKNIFLQFKKLCSF
R
ARRDLLQLSYGEAKKAARDYDLAKNYFKKSLRDMGYGNWISKPQEEKNFYLCPVPND




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser