NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40979.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40979.1 Public Mus musculus X Slc9a6 16 104 75 CCDS HistoryNCBI Gene:236794Re-query CCDS DB by CCDS ID:40979.1Re-query CCDS DB by GeneID:236794

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 40979.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000077741 ENSMUSP00000076922 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000077741Link to Ensembl Protein Viewer:ENSMUSP00000076922Re-query CCDS DB by Nucleotide ID:ENSMUST00000077741Re-query CCDS DB by Protein ID:ENSMUSP00000076922
Original member Current member EBI,WTSI OTTMUST00000042740 OTTMUSP00000019196 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000042740Link to Vega Protein Viewer:OTTMUSP00000019196Re-query CCDS DB by Nucleotide ID:OTTMUST00000042740Re-query CCDS DB by Protein ID:OTTMUSP00000019196
Original member Current member NCBI NM_172780.3 NP_766368.2 Accepted alive Link to Nucleotide Sequence:NM_172780.3Link to Protein Sequence:NP_766368.2Re-query CCDS DB by Nucleotide ID:NM_172780Re-query CCDS DB by Protein ID:NP_766368Link to BLink:NP_766368.2

Chromosomal Locations for CCDS 40979.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

Chromosome Start Stop Links
X 56609860 56610187 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56620326 56620525 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56622611 56622688 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56622988 56623064 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56623360 56623472 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56628394 56628499 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56633450 56633591 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56634786 56634891 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56635178 56635266 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56638275 56638388 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56643368 56643479 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56645800 56645953 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56651628 56651658 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56654974 56655053 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56658259 56658364 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56661176 56661448 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2109 nt):
ATGGCTGGGGCTCGGCGCGGCTGGCGGCTGGCGCCCGTTCGCCGTGGCGTCTGCGGGCCCCGGGCGCGTC
CG
CTCATGCGGCCCCTTTGGTTGCTCTTCGCAGTGAGCTTCTTTGGCTGGACCGGGGCTCTGGACGGCTC
C
GGGGGAACGACCAGAGCCATGGACGAGGAGATCGTGTCCGAGAAGCAGGCGGAGGAGAGCCATCGGCAG
GAC
AGCGCCAACCTGCTCATCTTCATCCTGCTGCTCACCCTCACCATTCTGACGATCTGGCTCTTCAAGC
AC
CGCCGGGCCCGCTTCCTGCACGAAACCGGCCTTGCTATGATTTATGGTCTTTTGGTAGGCCTCGTGCT
T
CGGTACGGCATTCATGTTCCAAGCGATGTGAATAATGTGACTCTGAGCTGTGAAGTGCAGTCAAGTCCA
ACT
ACCTTGTTGGTCAACGTCAGTGGAAAATTTTATGAGTATACGCTGAAAGGAGAGATTAGCTCACATG
AA
CTCAACAATGTTCAAGATAATGAAATGCTTAGGAAGGTTACTTTTGATCCAGAAGTCTTTTTCAACAT
A
CTGCTTCCTCCTATCATATTTTATGCAGGGTACAGTCTCAAAAGGAGACATTTCTTCCGGAACCTTGGG
TCT
ATCTTAGCATATGCCTTTCTTGGAACAGCAATTTCTTGTTTCGTTATTGGGTCCATCATGTATGGCT
GT
GTAACCCTGATGAAGGTGACCGGGCAGCTCGCGGGAGATTTTTACTTTACAGATTGCTTGCTGTTTGG
T
GCCATTGTTTCAGCCACCGACCCAGTGACTGTTCTTGCCATCTTCCATGAGCTTCAAGTTGACGTTGAA
CTC
TACGCTCTTCTCTTCGGGGAAAGTGTCCTCAATGACGCGGTTGCCATAGTGCTGTCCTCCTCAATAG
TG
GCATACCAGCCAGCGGGAGACAACAGCCACACCTTTGACGTTACAGCCATGTTCAAATCTATTGGAAT
C
TTCCTTGGGATCTTCAGTGGATCTTTTGCAATGGGTGCTGCAACAGGCGTGGTAACAGCTTTAGTGACA
AAG
TTCACAAAGCTGAGAGAGTTCCAGCTGTTGGAGACAGGCCTTTTCTTCTTGATGTCCTGGAGCACCT
TT
CTTCTGGCTGAAGCATGGGGTTTCACAGGTGTGGTTGCAGTATTGTTTTGTGGCATCACACAAGCACA
T
TACACGTACAATAATTTGTCTACAGAGTCTCAGCATAGAACAAAGCAGTTGTTTGAGCTTCTCAATTTT
TTA
GCGGAGAATTTCATCTTTTCCTACATGGGGCTGACGCTGTTCACCTTCCAGAATCACGTCTTTAACC
CA
ACATTTGTCGTAGGAGCATTCATTGCTATTTTCTTGGGAAGAGCTGCCAATATTTATCCCTTGTCTCT
C
TTACTTAATTTGGGTAGAAGAAGTAAGATTGGATCAAATTTTCAACACATGATGATGTTTGCTGGTCTT
CGT
GGTGCAATGGCATTTGCCTTGGCCATTCGAGATACTGCCACTTATGCACGACAAATGATGTTCAGCA
CC
ACACTTCTGATCGTGTTTTTTACTGTGTGGGTATTTGGTGGTGGCACCACTGCCATGCTGTCATGCCT
G
CATATAAGGGTTGGTGTTGATTCAGACCAAGAACATTTGGGTGTTCCTGACAACGAAAGGAGAACCACC
AAA
GCAGAGAGTGCCTGGCTCTTTCGGATGTGGTACAACTTCGATCATAACTATCTGAAGCCCCTGCTGA
CC
CACAGTGGGCCTCCTCTGACTACCACACTCCCAGCCTGCTGTGGGCCAATCGCCAGGTGCCTGACCAG
C
CCCCAAGCATATGAAAACCAGGAGCAGTTGAAAGATGATGACTCTGATCTCATTCTCAATGATGGTGAT
ATC
AGTCTGACATATGGGGATTCTACTGTGAACACCGAGTCCGCAACAGCCAGCGCCCCAAGGAGATTTA
TG
GGCAACAGTTCTGAAGATGCCTTGGACCGGGAGCTTACATTTGGGGACCACGAACTAGTCATTCGTGG
C
ACACGCCTGGTTCTTCCGATGGATGATTCTGAACCTGCGTTAAATTCATTAGATGATACGAGACACAGT
CCG
GCCTAA


Translation (702 aa):
MAGARRGWRLAPVRRGVCGPRARPLMRPLWLLFAVSFFGWTGALDGSGGTTRAMDEEIVSEKQAEESHRQ
D
SANLLIFILLLTLTILTIWLFKHRRARFLHETGLAMIY
GLLVGLVLRYGIHVPSDVNNVTLSCEVQSSP
T
TLLVNVSGKFYEYTLKGEISSHELNNVQDNEMLRK
VTFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLG
S
ILAYAFLGTAISCFVI
GSIMYGCVTLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFHELQVDVE
L
YALLFGESVLNDAVAIVLS
SSIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFSGSFAMGAATGVVTALVT
K
FTKLREFQLLETGLFFLMSWSTFLLAEAWGFT
GVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNF
L
AENFIFSYMGLTLFTFQNHVFNPTFVVGAF
IAIFLGRAANIYPLSLLLNLGRRSKIGSNFQHMMMFAGL
R
GAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCLHI
RVGVDSDQEHLGVPDNERRTT
K
AESAWLFRMWYNFDH
NYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILNDGD
I
SLTYGDSTVNTESATASAPRRFMGNSSEDALDRELTFGDHELVIRGTRLVLPMDDSEPALNSLDDTRHS
P
A




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser