NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS56638.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56638.1 Public Mus musculus 1 Atg16l1 16 104 75 CCDS HistoryNCBI Gene:77040Re-query CCDS DB by CCDS ID:56638.1Re-query CCDS DB by GeneID:77040See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Sequence IDs included in CCDS 56638.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000113186 ENSMUSP00000108811 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113186Link to Ensembl Protein Viewer:ENSMUSP00000108811Re-query CCDS DB by Nucleotide ID:ENSMUST00000113186Re-query CCDS DB by Protein ID:ENSMUSP00000108811
Original member Current member EBI,WTSI OTTMUST00000042059 OTTMUSP00000018916 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000042059Link to Vega Protein Viewer:OTTMUSP00000018916Re-query CCDS DB by Nucleotide ID:OTTMUST00000042059Re-query CCDS DB by Protein ID:OTTMUSP00000018916
Original member Current member NCBI NM_001205392.1 NP_001192321.1 Accepted alive Link to Nucleotide Sequence:NM_001205392.1Link to Protein Sequence:NP_001192321.1Re-query CCDS DB by Nucleotide ID:NM_001205392Re-query CCDS DB by Protein ID:NP_001192321Link to BLink:NP_001192321.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001192321.1 588 Q8C0J2-2 588 100% 0 0

Chromosomal Locations for CCDS 56638.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 87756200 87756314 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87760051 87760144 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87765338 87765443 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87766109 87766182 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87766806 87767057 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87771392 87771457 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87774145 87774231 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87775757 87775859 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87778922 87779027 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87780125 87780195 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87781671 87781742 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87785876 87785996 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87786241 87786346 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87789331 87789480 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87789572 87789619 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87790586 87790687 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87791216 87791309 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1767 nt):
ATGTCGTCGGGCCTGCGCGCCGCAGACTTTCCCCGCTGGAAGCGTCACATCGCGGAGGAACTGAGGCGCC
GG
GACCGACTGCAGAGGCAGGCGTTCGAGGAGATCATTCTGCAGTATACCAAGTTGCTGGAAAAGTCAGA
T
CTTCATTCAGTATTGACCCAGAAACTACAAGCAGAAAAGCATGACATGCCAAATAGGCATGAAATAAGT
CCT
GGACATGATGGTGCGTGGAATGATAGTCAACTACAAGAAATGGCCCAGTTGAGGATCAAACACCAGG
AA
GAGCTGACCGAACTGCACAAGAAGCGTGGGGAGTTAGCTCAGTTGGTGATTGACCTGAACAACCAAAT
G
CAGCAGAAGGACAAGGAGATACAGATGAATGAAGCAAAGATTTCGGAGTATTTACAGACCATCTCTGAC
CTG
GAGACAAACTGCCTGGACCTGCGCACCAAACTGCAGGACCTCGAGGTAGCCAACCAGACCCTGAAGG
AT
GAGTATGACGCCCTGCAGATTACTTTTACTGCCCTAGAAGAGAAACTGAGGAAAACTACTGAGGAGAA
C
CAGGAACTGGTCACCAGATGGATGGCTGAGAAGGCCCAAGAAGCCAATCGCCTCAATGCAGAGAATGAG
AAG
GACTCCAGGAGGCGTCAAGCACGGCTGCAGAAGGAGCTTGCAGAAGCAGCAAAGGAACCTCTACCTG
TT
GAACAGGATGATGACATTGAAGTCATTGTGGATGAGACCTCAGACCACACAGAAGAGACCTCTCCCGT
C
CGAGCTGTCAGCAGAGCAGCTACGAGACGCTCTGTCTCTTCCATCCCAGTCCCCCAGGATATCATGGAC
ACT
CATCCTGCTTCTGGTAAAGATGTGAGAGTCCCAACTACTGCCTCGTATGTCTTCGATGCGCATGACG
GA
GAGGTCAACGCAGTGCAGTTCAGTCCAGGCTCCCGGTTGCTGGCCACTGGAGGCATGGACCGCAGGGT
G
AAACTTTGGGAAGCATTCGGAGATAAATGTGAATTCAAGGGCTCCCTGTCTGGCAGTAATGCTGGAATT
ACA
AGCATTGAATTTGATAGTGCTGGAGCTTACCTATTAGCAGCTTCAAATGATTTTGCAAGCCGAATCT
GG
ACTGTGGATGATTATCGATTACGGCACACACTCACAGGCCACAGCGGGAAAGTCCTCTCTGCCAAGTT
C
CTGCTGGACAATGCACGGATTGTCTCAGGAAGTCACGACCGGACCCTCAAACTCTGGGATCTCCGCAGC
AAA
GTCTGCATAAAAACAGTGTTTGCAGGATCCAGCTGCAATGACATTGTTTGCACTGAACAATGTGTAA
TG
AGTGGACATTTTGACAAGAAAATTCGTTTCTGGGATATCCGGTCAGAGAGTGTGGTCCGAGAGATGGA
A
CTGTTAGGGAAGATCACTGCTCTGGACCTAAACCCTGAGAGAACTGAGCTCCTGAGCTGCTCCCGTGAT
GAC
CTGCTAAAAGTCATCGACCTCCGGACAAATGCAGTCAAACAGACATTCAGTGCGCCTGGATTCAAAT
GC
GGCTCTGACTGGACCCGGGTTGTCTTCAGCCCTGATGGCAGTTACGTGGCAGCAGGCTCAGCCGAGGG
T
TCTCTTTATGTCTGGAGTGTGCTGACAGGGAAAGTGGAGAAGGTTCTTTCAAAACAGCACAGCTCTTCT
ATC
AATGCGGTGGCGTGGGCCCCCTCGGGCTTACATGTTGTCAGTGTGGACAAAGGAAGCAGAGCTGTGC
TG
TGGGCACAGCCTTGA


Translation (588 aa):
MSSGLRAADFPRWKRHIAEELRRRDRLQRQAFEEIILQYTKLLEKSDLHSVLTQKLQAEKHDMPNRHEIS
P
GHDGAWNDSQLQEMAQLRIKHQEELTELHKKRGE
LAQLVIDLNNQMQQKDKEIQMNEAKISEYLQTISD
L
ETNCLDLRTKLQDLEVANQTLKDEYDALQITFTALEEKLRKTTEENQELVTRWMAEKAQEANRLNAENE
K
DS
RRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAVSRAATRRSVSSIPVPQDIMD
T
HPASGKDVRVPTTASYVF
DAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGI
T
SIEFDSA
GAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRS
K
V
CIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESVVREMELLGKITALDLNPERTELLSCSRD
D
LLKVIDLRTNAVKQTF
SAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSVLTGKVEKVLSKQHSSS
I
NAVAWAPSGLHVVSVDKGSRAVLWAQP




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser