NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18501.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18501.1 Public Mus musculus 4 Faah 16 104 75 CCDS HistoryNCBI Gene:14073Re-query CCDS DB by CCDS ID:18501.1Re-query CCDS DB by GeneID:14073

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 18501.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000049095 ENSMUSP00000041543 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000049095Link to Ensembl Protein Viewer:ENSMUSP00000041543Re-query CCDS DB by Nucleotide ID:ENSMUST00000049095Re-query CCDS DB by Protein ID:ENSMUSP00000041543
Original member Current member EBI,WTSI OTTMUST00000019833 OTTMUSP00000009093 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000019833Link to Vega Protein Viewer:OTTMUSP00000009093Re-query CCDS DB by Nucleotide ID:OTTMUST00000019833Re-query CCDS DB by Protein ID:OTTMUSP00000009093
Original member Current member NCBI NM_010173.4 NP_034303.3 Accepted alive Link to Nucleotide Sequence:NM_010173.4Link to Protein Sequence:NP_034303.3Re-query CCDS DB by Nucleotide ID:NM_010173Re-query CCDS DB by Protein ID:NP_034303Link to BLink:NP_034303.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034303.3 579 O08914 579 100% 0 0

Chromosomal Locations for CCDS 18501.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 115998487 115998615 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 115998821 115998966 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 115999499 115999607 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 116000049 116000088 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 116000787 116000827 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 116001104 116001203 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 116002458 116002555 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 116002977 116003102 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 116004355 116004479 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 116004714 116004754 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 116005000 116005206 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 116005301 116005434 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 116005587 116005721 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 116008180 116008293 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 116017463 116017657 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1740 nt):
ATGGTGCTGAGCGAAGTGTGGACCGCGCTGTCTGGACTCTCCGGGGTTTGCCTAGCCTGCAGCTTGCTGT
CG
GCGGCGGTGGTCCTGCGATGGACCAGGAGCCAGACCGCCCGGGGCGCGGTGACCAGGGCGCGGCAGAA
G
CAGCGAGCCGGCCTGGAGACCATGGACAAGGCGGTGCAGCGCTTCCGGCTGCAGAATCCTGACCTGGAT
TCA
GAGGCCTTGCTGGCTCTGCCCCTGCTCCAACTGGTACAGAAGTTACAGAGTGGGGAACTGTCCCCAG
AA
GCTGTGCTCTTTACCTACCTGGGAAAGGCCTGGGAAGTGAACAAAGGGACCAACTGTGTGACCTCCTA
T
CTGACTGACTGTGAGACTCAGCTGTCCCAGGCCCCACGGCAGGGCCTGCTCTATGGCGTCCCCGTGAGC
CTC
AAGGAATGCTTCAGCTACAAGGGCCATGCTTCCACACTGGGCTTAAGTTTGAACGAGGGTGTGACAT
CG
GAGAGTGACTGTGTGGTGGTGCAGGTACTGAAGCTGCAGGGAGCTGTGCCCTTTGTGCACACCAACGT
C
CCCCAGTCCATGCTAAGCTATGACTGCAGTAACCCCCTCTTTGGCCAGACCATGAACCCGTGGAAGCCC
TCC
AAGAGTCCAGGAGGTTCCTCAGGGGGTGAGGGGGCTCTCATTGGATCTGGAGGCTCCCCTCTGGGTT
TA
GGCACTGACATCGGCGGCAGCATCCGGTTCCCTTCTGCCTTCTGTGGCATCTGTGGCCTCAAGCCTAC
T
GGGAACCGCCTCAGCAAGAGTGGCCTGAAGAGCTGTGTTTATGGACAGACAGCAGTGCAGCTTTCTGTT
GGC
CCCATGGCACGGGATGTGGATAGCCTGGCATTGTGCATGAAAGCCCTACTTTGTGAGGATTTGTTCC
GC
TTGGACTCCACCATCCCCCCCTTGCCCTTCAGGGAGGAGATCTACAGAAGTTCTCGACCCCTTCGTGT
G
GGATACTATGAAACTGACAACTACACCATGCCCACTCCAGCCATGAGGAGGGCTGTGATGGAGACCAAG
CAG
AGTCTCGAGGCTGCTGGCCACACGCTGGTCCCCTTCTTACCAAACAACATACCTTATGCCCTGGAGG
TC
CTGTCGGCAGGTGGGCTGTTCAGTGATGGTGGCTGCTCTTTTCTCCAAAACTTCAAAGGCGACTTTGT
G
GATCCCTGCTTGGGGGACCTGGTCTTAGTGCTGAAGCTGCCCAGGTGGTTTAAAAAACTGCTGAGCTTC
CTG
CTGAAGCCTCTGTTTCCTCGGCTGGCAGCCTTTCTCAACAGTATGTGTCCTCGGTCAGCCGAAAAGC
TG
TGGGAACTGCAGCATGAGATTGAGATGTATCGCCAGTCCGTCATTGCCCAGTGGAAGGCAATGAACTT
G
GACGTGGTGCTAACCCCCATGCTGGGTCCTGCTCTGGATTTGAACACACCGGGCAGAGCCACAGGGGCT
ATC
AGCTACACTGTTCTCTATAACTGCCTGGACTTCCCTGCGGGGGTGGTGCCTGTCACCACTGTGACCG
CT
GAGGACGATGCCCAGATGGAACACTACAAAGGCTACTTTGGGGATATGTGGGACAACATTCTGAAGAA
G
GGCATGAAAAAGGGTATAGGCCTGCCTGTGGCTGTGCAGTGCGTGGCTCTGCCCTGGCAGGAAGAGCTG
TGT
CTGCGGTTCATGCGGGAGGTGGAACGGCTGATGACCCCTGAAAAGCGGCCATCTTGA


Translation (579 aa):
MVLSEVWTALSGLSGVCLACSLLSAAVVLRWTRSQTARGAVTRARQKQRAGLETMDKAVQRFRLQNPDLD
S
EALLALPLLQLVQKLQSGELSPEAVLFTYLGK
AWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVS
L
KECFSYK
GHASTLGLSLNEGVTSESDCVVVQVLKLQGAVPFVHTNVPQSMLSYDCSNPLFGQTMNPWKP
S
KSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRL
SKSGLKSCVYGQTAVQLSV
G
PMARDVDSLALCMKALLCEDLFRLDSTIPPLPFREE
IYRSSRPLRVGYYETDNYTMPTPAMRRAVMETK
Q
SLEAAGHT
LVPFLPNNIPYALEVLSAGGLFSDGGCSFLQNFKGDFVDPCLGDLVLVLKLPRWFKKLLSF
L
LKPL
FPRLAAFLNSMCPRSAEKLWELQHEIEMYRQSVIAQWKAMNLDVVLTPMLGPALDLNTPGRATGA
I
SYTVLYNCLDFPAGVVPVTTVTAEDDAQMEHYKGYFGDMWDNILKK
GMKKGIGLPVAVQCVALPWQEEL
C
LRFMREVERLMTPEKRPS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser