NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18070.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18070.1 Public Mus musculus 4 Sigmar1 16 104 75 CCDS HistoryNCBI Gene:18391Re-query CCDS DB by CCDS ID:18070.1Re-query CCDS DB by GeneID:18391

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 18070.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000059354 ENSMUSP00000056027 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000059354Link to Ensembl Protein Viewer:ENSMUSP00000056027Re-query CCDS DB by Nucleotide ID:ENSMUST00000059354Re-query CCDS DB by Protein ID:ENSMUSP00000056027
Original member Current member EBI,WTSI OTTMUST00000015282 OTTMUSP00000007061 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000015282Link to Vega Protein Viewer:OTTMUSP00000007061Re-query CCDS DB by Nucleotide ID:OTTMUST00000015282Re-query CCDS DB by Protein ID:OTTMUSP00000007061
Original member Current member NCBI NM_011014.3 NP_035144.1 Accepted alive Link to Nucleotide Sequence:NM_011014.3Link to Protein Sequence:NP_035144.1Re-query CCDS DB by Nucleotide ID:NM_011014Re-query CCDS DB by Protein ID:NP_035144Link to BLink:NP_035144.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035144.1 223 O55242-1 223 100% 0 0

Chromosomal Locations for CCDS 18070.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 41739354 41739580 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 41740550 41740642 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 41740776 41740976 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 41741102 41741252 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (672 nt):
ATGCCGTGGGCCGCGGGACGGCGGTGGGCATGGATCACCCTGATTCTGACTATTATCGCAGTGCTGATCC
AG
GCCGCCTGGTTGTGGCTGGGCACTCAAAACTTCGTCTTCTCTAGAGAAGAAATAGCGCAGCTTGCTCG
A
CAGTATGCGGGGCTGGACCATGAGCTTGCCTTCTCTCGGCTGATCGTGGAGCTGCGGAGGCTGCACCCA
GGC
CACGTGCTGCCGGATGAGGAGCTGCAGTGGGTATTTGTGAACGCGGGCGGCTGGATGGGCGCCATGT
GT
ATTCTGCACGCCTCGCTGTCTGAGTACGTGCTGCTCTTCGGCACCGCCCTGGGCTCCCATGGCCATTC
G
GGACGATACTGGGCTGAGATTTCTGACACCATCATCTCTGGCACCTTCCACCAATGGAAAGAGGGCACC
ACG
AAAAGTGAGGTCTTCTACCCAGGAGAGACAGTTGTACACGGGCCTGGAGAAGCAACGGCTCTGGAGT
GG
GGACCAAACACGTGGATGGTGGAGTACGGCCGGGGTGTTATTCCGTCTACCCTGTTCTTTGCACTAGC
C
GACACTTTCTTCAGCACCCAGGACTACCTCACACTCTTCTATACCCTTCGGGCCTATGCCCGGGGCCTC
CGG
CTTGAGCTTACCACCTACCTCTTTGGCCAAGACTCCTGA


Translation (223 aa):
MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSRLIVELRRLHP
G
HVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHS
GRYWAEISDTIISGTFHQWKEGT
T
KSEVFYP
GETVVHGPGEATALEWGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYARGL
R
LELTTYLFGQDS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser