NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25217.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25217.1 Public Mus musculus 11 Mpo 19 105 81 CCDS HistoryNCBI Gene:17523Re-query CCDS DB by CCDS ID:25217.1Re-query CCDS DB by GeneID:17523See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 25217.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020779 ENSMUSP00000020779 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020779Link to Ensembl Protein Viewer:ENSMUSP00000020779Re-query CCDS DB by Nucleotide ID:ENSMUST00000020779Re-query CCDS DB by Protein ID:ENSMUSP00000020779
Original member Current member EBI,WTSI ENSMUST00000121303 ENSMUSP00000112837 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000121303Link to Ensembl Protein Viewer:ENSMUSP00000112837Re-query CCDS DB by Nucleotide ID:ENSMUST00000121303Re-query CCDS DB by Protein ID:ENSMUSP00000112837
Original member Current member EBI,WTSI OTTMUST00000002817 OTTMUSP00000001371 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000002817Link to Vega Protein Viewer:OTTMUSP00000001371Re-query CCDS DB by Nucleotide ID:OTTMUST00000002817Re-query CCDS DB by Protein ID:OTTMUSP00000001371
Original member Current member EBI,WTSI OTTMUST00000002819 OTTMUSP00000034233 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000002819Link to Vega Protein Viewer:OTTMUSP00000034233Re-query CCDS DB by Nucleotide ID:OTTMUST00000002819Re-query CCDS DB by Protein ID:OTTMUSP00000034233
Original member Current member NCBI NM_010824.2 NP_034954.2 Accepted alive Link to Nucleotide Sequence:NM_010824.2Link to Protein Sequence:NP_034954.2Re-query CCDS DB by Nucleotide ID:NM_010824Re-query CCDS DB by Protein ID:NP_034954Link to BLink:NP_034954.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034954.2 718 P11247 718 100% 0 0

Chromosomal Locations for CCDS 25217.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 87794539 87794614 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 87794774 87794867 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 87795196 87795371 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 87795798 87795921 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 87796017 87796146 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 87796230 87796436 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 87797324 87797642 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 87799864 87800024 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 87801030 87801285 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 87801581 87801751 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 87802512 87802749 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 87803398 87803602 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2157 nt):
ATGAAGCTACTCTTGGCCTTGGCAGGCCTCCTGGCCCCTCTGGCCATGCTTCAGACCTCCAATGGTGCCA
CC
CCAGCTCTCCTGGGGGAAGTGGAGAATTCAGTTGTGCTGAGCTGTATGGAAGAGGCCAAGCAGCTAGT
G
GACAGAGCCTACAAGGAGCGGAGAGAAAGCATCAAGCGGAGCCTCCAAAGCGGCTCTGCCAGCCCCACG
GAG
CTCCTGTTTTACTTCAAGCAGCCGGTGGCGGGCACCAGAACAGCTGTGAGGGCCGCTGATTATCTAC
AT
GTGGCCCTAGACCTGCTGAAGAGGAAGCTGCAGCCCCTGTGGCCAAGGCCTTTCAATGTTACAGATGT
G
TTGACACCTGCTCAGCTGAATCTGTTGTCCGTGTCAAGTGGCTGTGCCTATCAGGACGTGAGGGTGACA
TGC
CCACCGAATGACAAGTATCGCACCATCACTGGACACTGCAACAACAGACGAAGCCCCACTCTGGGGG
CC
TCCAACCGTGCCTTTGTACGCTGGTTGCCTGCAGAGTATGAAGATGGCGTCTCCATGCCCTTTGGCTG
G
ACGCCTGGAGTCAATCGCAATGGCTTCAAGGTGCCCCTGGCTCGCCAGGTCTCCAATGCCATCGTGCGC
TTC
CCCAACGATCAGCTGACCAAGGACCAGGAGCGTGCACTCATGTTCATGCAGTGGGGACAGTTTCTGG
AT
CATGATATCACCTTGACTCCAGAGCCAGCTACCCGGTTCTCCTTCTTCACTGGCCTCAACTGCGAGAC
C
AGCTGCCTGCAGCAGCCACCCTGCTTCCCCCTCAAGATCCCACCCAATGACCCTCGAATCAAGAACCAA
AAG
GACTGCATCCCCTTCTTCCGCTCCTGCCCGGCATGCACCAGGAACAACATCACCATTCGCAACCAGA
TC
AACGCGCTCACTTCCTTCGTGGACGCCAGCGGGGTGTACGGCAGCGAGGACCCCCTAGCCAGAAAGCT
G
CGCAACCTCACCAACCAGCTGGGGCTGCTGGCTATCAATACACGCTTCCAAGACAATGGCAGGGCCCTG
ATG
CCCTTTGACAGCCTGCACGATGACCCCTGCCTCCTCACCAACCGCTCCGCCCGCATTCCTTGTTTTC
TG
GCAGGGGACATGCGCTCCAGCGAGATGCCGGAGCTCACCTCCATGCACACCCTCTTTGTTCGAGAGCA
T
AACCGGCTGGCCACACAGCTCAAGCGCCTGAATCCTCGATGGAATGGGGAGAAGCTCTACCAGGAGGCC
CGG
AAGATTGTAGGGGCCATGGTCCAGATCATCACATACCGGGACTACCTGCCCTTGGTGTTGGGGCCAG
CA
GCCATGAAGAAGTACCTACCCCAGTACCGATCTTACAACGACTCAGTAGACCCTCGAATCGCCAATGT
C
TTCACCAACGCTTTCCGTTATGGCCACACCCTCATCCAACCCTTCATGTTCCGCCTGAACAATCAGTAC
CGG
CCCACAGGGCCCAACCCCCGAGTCCCACTCAGCAAGGTCTTTTTTGCCAGCTGGAGAGTCGTGTTGG
AA
GGTGGCATTGACCCCATCCTCCGAGGCCTCATGGCCACTCCAGCCAAACTGAATCGCCAGAATCAAAT
T
GTGGTGGATGAGATCCGGGAGCGACTATTTGAGCAAGTCATGAGGATAGGACTGGATTTGCCTGCTCTT
AAC
ATGCAGCGCAGCCGGGATCACGGCCTCCCAGGATACAATGCCTGGAGACGCTTTTGTGGGCTTCCAC
AG
CCCAGCACAGTGGGTGAGCTCGGCACGGTGCTGAAGAACCTGGAGTTGGCACGGAAGCTGATGGCACA
A
TATGGCACGCCCAACAACATTGACATCTGGATGGGCGGTGTGTCCGAGCCCCTGGAGCCCAATGGCCGT
GTA
GGCCAGCTCCTTGCCTGCCTCATTGGCACTCAGTTTAGGAAGCTACGTGATGGTGATCGGTTTTGGT
GG
GAGAACCCAGGCGTGTTCAGTAAACAGCAGAGACAGGCCTTGGCCAGCATCTCCTTGCCCCGTATCAT
C
TGTGACAACACTGGCATCACCACCGTGTCGAAGAACAACATCTTCATGTCCAACACATACCCCCGAGAC
TTT
GTCAGCTGTAACACCCTTCCTAAACTGAACCTGACTTCCTGGAAGGAGACCTAG


Translation (718 aa):
MKLLLALAGLLAPLAMLQTSNGATPALLGEVENSVVLSCMEEAKQLVDRAYKERRESIKRSLQSGSASPT
E
LLFYFKQPVAGTRTAVRAADYLHVALDLLKRKLQPLWPRPFNVT
DVLTPAQLNLLSVSSGCAYQDVRVT
C
PPNDKYRTITGHCNN
RRSPTLGASNRAFVRWLPAEYEDGVSMPFGWTPGVNRNGFKVPLARQVSNAIVR
F
PNDQLTKDQERALMFMQWGQFLDHDITLTPEPATRFSFFTGLNCETSCLQQPPCFPLK
IPPNDPRIKNQ
K
DCIPFFRSCPACTRNNITIRNQINALTSFVDASGVYGSEDPLARKLRNLTNQLGLLAINTRFQDNGRAL
M
PFDSLHDDPCLLTNRSARIPCFLA
GDMRSSEMPELTSMHTLFVREHNRLATQLKRLNPRWNGEKLYQEA
R
KIVGAMVQ
IITYRDYLPLVLGPAAMKKYLPQYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLNNQY
R
PTGPNPRVPLSKVFFASWRVVLE
GGIDPILRGLMATPAKLNRQNQIVVDEIRERLFEQVMRIGLDLPAL
N
MQRSRDHGLP
GYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQYGTPNNIDIWMGGVSEPLEPNGR
V
GQLLACLIGTQFRKLRDGD
RFWWENPGVFSKQQRQALASISLPRIICDNTGITTVSKNNIFMSNTYPRD
F
VSCNTLPKLNLTSWKET




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser