NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19193.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19193.1 Public Mus musculus 5 Ppp1cb 16 104 75 CCDS HistoryNCBI Gene:19046Re-query CCDS DB by CCDS ID:19193.1Re-query CCDS DB by GeneID:19046See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19193.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000015100 ENSMUSP00000015100 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000015100Link to Ensembl Protein Viewer:ENSMUSP00000015100Re-query CCDS DB by Nucleotide ID:ENSMUST00000015100Re-query CCDS DB by Protein ID:ENSMUSP00000015100
Original member Current member EBI,WTSI ENSMUST00000131300 ENSMUSP00000121550 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000131300Link to Ensembl Protein Viewer:ENSMUSP00000121550Re-query CCDS DB by Nucleotide ID:ENSMUST00000131300Re-query CCDS DB by Protein ID:ENSMUSP00000121550
Original member Current member EBI,WTSI OTTMUST00000059605 OTTMUSP00000029005 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000059605Link to Vega Protein Viewer:OTTMUSP00000029005Re-query CCDS DB by Nucleotide ID:OTTMUST00000059605Re-query CCDS DB by Protein ID:OTTMUSP00000029005
Original member Current member EBI,WTSI OTTMUST00000059606 OTTMUSP00000029006 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000059606Link to Vega Protein Viewer:OTTMUSP00000029006Re-query CCDS DB by Nucleotide ID:OTTMUST00000059606Re-query CCDS DB by Protein ID:OTTMUSP00000029006
Original member Current member NCBI NM_172707.3 NP_766295.2 Accepted alive Link to Nucleotide Sequence:NM_172707.3Link to Protein Sequence:NP_766295.2Re-query CCDS DB by Nucleotide ID:NM_172707Re-query CCDS DB by Protein ID:NP_766295Link to BLink:NP_766295.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_766295.2 327 P62141 327 100% 0 0

Chromosomal Locations for CCDS 19193.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 32459356 32459407 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 32478066 32478197 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 32480690 32480920 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 32483360 32483464 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 32485259 32485330 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 32485881 32486032 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 32487571 32487705 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 32490954 32491058 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (984 nt):
ATGGCGGACGGGGAGCTGAACGTGGACAGCCTCATCACCCGCCTGCTGGAGGTACGAGGATGTCGTCCAG
GA
AAGATTGTACAAATGACTGAAGCAGAAGTCCGAGGGTTGTGTATCAAGTCTCGTGAAATCTTTCTCAG
C
CAGCCTATTCTTTTGGAATTGGAAGCACCACTGAAGATTTGTGGAGACATTCATGGACAATATACAGAC
TTA
CTAAGATTATTTGAATATGGAGGTTTTCCACCAGAAGCCAACTATCTTTTCTTAGGAGATTATGTGG
AC
AGAGGAAAGCAGTCTTTGGAAACCATCTGTTTGCTATTGGCTTACAAAATCAAATACCCGGAGAACTT
C
TTTCTTCTAAGAGGAAACCATGAGTGTGCTAGCATCAATCGCATTTATGGATTCTACGATGAGTGTAAA
CGA
AGATTTAATATTAAATTGTGGAAGACATTCACTGATTGTTTTAACTGTCTGCCTATAGCTGCTATTG
TT
GATGAGAAAATCTTCTGTTGTCATGGAGGACTGTCACCAGACCTACAATCTATGGAACAGATTCGGAG
A
ATTATGAGACCCACTGACGTACCTGATACAGGTTTGCTTTGTGACTTACTGTGGTCCGACCCAGATAAG
GAT
GTGCAAGGCTGGGGAGAAAATGACCGTGGTGTTTCTTTTACTTTTGGAGCTGATGTAGTCAGTAAAT
TT
CTGAATCGTCATGATTTAGACTTGATTTGTCGAGCTCATCAGGTGGTGGAAGACGGATATGAATTTTT
T
GCTAAACGACAGTTGGTAACCTTATTTTCTGCCCCAAATTACTGTGGCGAGTTTGACAATGCTGGTGGT
ATG
ATGAGTGTGGATGAGACTTTGATGTGTTCATTCCAGATATTGAAACCATCTGAAAAGAAAGCTAAGT
AC
CAGTATGGTGGGCTGAATTCTGGACGTCCTGTCACTCCGCCTCGAACAGCTAATCCACCGAAGAAAAG
G
TGA


Translation (327 aa):
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTD
L
LRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDE
CK
R
RFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHG
GLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDK
D
VQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQ
VVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGG
M
MSVDETLMCSFQ
ILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser