NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15374.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15374.1 Public Mus musculus 1 Npl 16 104 75 CCDS HistoryNCBI Gene:74091Re-query CCDS DB by CCDS ID:15374.1Re-query CCDS DB by GeneID:74091See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 15374.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000041874 ENSMUSP00000037454 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000041874Link to Ensembl Protein Viewer:ENSMUSP00000037454Re-query CCDS DB by Nucleotide ID:ENSMUST00000041874Re-query CCDS DB by Protein ID:ENSMUSP00000037454
Original member Current member NCBI NM_028749.1 NP_083025.1 Accepted alive Link to Nucleotide Sequence:NM_028749.1Link to Protein Sequence:NP_083025.1Re-query CCDS DB by Nucleotide ID:NM_028749Re-query CCDS DB by Protein ID:NP_083025Link to BLink:NP_083025.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_083025.1 320 Q9DCJ9 320 100% 0 0

Chromosomal Locations for CCDS 15374.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 153503373 153503557 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 153509112 153509151 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 153512546 153512630 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 153515240 153515286 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 153515402 153515550 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 153518883 153518975 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 153524347 153524422 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 153528065 153528122 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 153535872 153535959 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 153537428 153537501 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 153545263 153545330 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (963 nt):
ATGGCCTTCCCTAAGAAGAAACTCCGGGGTCTTGTTGCTGCCACCATCACTCCAATGACAGAGAATGGAG
AA
ATCAACTTTCCTGTCATTGGTCAGTATGTGGATTACCTGGTGAAGGAACAGGGGGTGAAGAATATTTT
T
GTGAATGGCACCACAGGAGAAGGCCTGTCCCTGAGCGTCTCTGAACGTCGCCAGGTCGCGGAGGAATGG
GTT
AACCAAGGGAGGAACAAGTTGGACCAGGTGGTGATTCACGTGGGAGCACTAAACGTGAAGGAGTCAC
AA
GAACTGGCCCAACATGCAGCAGAAATTGGAGCTGATGGCATTGCTGTCATTGCGCCTTTCTTTTTCAA
G
TCACAGAACAAAGATGCCCTGATAAGCTTCCTGAGAGAGGTGGCAGCCGCAGCTCCTACTTTGCCATTT
TAT
TACTACCACATGCCTTCCATGACCGGGGTAAAGATTCGCGCTGAGGAGCTGCTGGACGGGATTCAGG
AC
AAGATCCCCACCTTCCAAGGACTGAAGTTCACCGACACGGACCTCTTGGATTTCGGCCAATGTGTCGA
T
CAGAATCACCAGCGACAGTTTGCTTTGCTCTTTGGGGTGGACGAACAACTGCTGAGTGCTCTGGTCATG
GGA
GCCACTGGAGCAGTAGGCAGTACCTATAACTACCTGGGAAAAAAGACAAACCAGATGTTGGAAGCTT
TT
GAACAGAAGGACTTGGCTTCAGCGCTCAGTTACCAGTTTCGTATCCAGAGATTTATCAACTATGTGAT
C
AAGCTAGGTTTTGGAGTGTCGCAAACCAAAGCCATCATGACGCTGGTCTCTGGGATTCCAATGGGCCCA
CCC
CGGCTTCCTCTGCAGAAAGCCACCCAGGAGTTTACTGCTAAGGCTGAGGCCAAGCTAAAGAGCCTGG
AT
TTCCTTTCTTCCCCTAGTGTAAAGGAGGGGAAGCCTTTAGCTAGTGCCTGA


Translation (320 aa):
MAFPKKKLRGLVAATITPMTENGEINFPVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEW
V
NQGRN
KLDQVVIHVGALNVKESQELAQHAAEIGADGIAVIAPFFFKSQNKDALISFLREVAAAAPTLPF
Y
YYHMPSMTGVK
IRAEELLDGIQDKIPTFQGLKFTDTDLLDFGQCVDQNHQRQFALLFGVDEQLLSALVM
G
ATGAVG
STYNYLGKKTNQMLEAFEQKDLASALSYQFRIQRFINYVIKLGFGVSQTKAIMTLVSGIPMGP
P
RLPLQKATQEFTAKAEAKLKSLDFLSSPSVKEGKPLASA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser