NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29467.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29467.1 Public Mus musculus 19 Mus81 16 104 75 CCDS HistoryNCBI Gene:71711Re-query CCDS DB by CCDS ID:29467.1Re-query CCDS DB by GeneID:71711See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 29467.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000124334 ENSMUSP00000114895 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000124334Link to Ensembl Protein Viewer:ENSMUSP00000114895Re-query CCDS DB by Nucleotide ID:ENSMUST00000124334Re-query CCDS DB by Protein ID:ENSMUSP00000114895
Original member Current member EBI,WTSI OTTMUST00000085631 OTTMUSP00000046281 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000085631Link to Vega Protein Viewer:OTTMUSP00000046281Re-query CCDS DB by Nucleotide ID:OTTMUST00000085631Re-query CCDS DB by Protein ID:OTTMUSP00000046281
Original member Current member NCBI NM_027877.3 NP_082153.3 Accepted alive Link to Nucleotide Sequence:NM_027877.3Link to Protein Sequence:NP_082153.3Re-query CCDS DB by Nucleotide ID:NM_027877Re-query CCDS DB by Protein ID:NP_082153Link to BLink:NP_082153.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_082153.3 551 Q91ZJ0 551 100% 0 0

Chromosomal Locations for CCDS 29467.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 5482963 5483029 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5483108 5483191 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5483455 5483558 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5483635 5483763 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5483930 5484025 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5484113 5484229 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5484859 5484956 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5485039 5485160 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5485258 5485353 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5485488 5485625 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5486029 5486114 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5486280 5486348 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5486487 5486588 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5487025 5487107 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5487762 5487891 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5487988 5488122 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1656 nt):
ATGGCGGAGCCGGTCCGCCTGGGCCGGAAGCGTCCGCTGCCCGTTTGCCCCAACCCGCTCTTCGTTCGTT
GG
CTGACCGAGTGGCGGGACGAGGCAGCCAGCAGGGGGCGCCACACGCGTTTCGTGTTTCAAAAGGCATT
G
CGCTCCCTCCAACGGTACCCGCTACCATTGCGCAGCGGGAAGGAAGCCAAGATACTCCAGCACTTCGGA
GAC
AGGCTCTGCCGCATGCTGGACGAAAAGCTGAAGCAGCACCTAGCATCAGGCGGTGACCATGCCCCCA
GC
TCACCATCTGGAAAGAAGGGAGCCAGCAAAGGGCCACCTGAGCAAGTCCAGGACTCTTCCATGCCAGT
T
CCCACCCAGCCTCAAGCAGGAAGCACCAGTGTTGGCTATTGGCCAGCTCAGAACTCAGGTGCTCGAGAG
ATC
CTGCTGCAACTCTACAGGGAGCACCTGAATTCTGATGGCCACAGCTTCCTAACCAAAGAGGAGCTGC
TG
CAGAAGTGTGCCCAGAAGACCCCCAGGGTAGTGCCTGGAAGTTCGAAACCCTGGCCTGCCCTCCGGAG
C
CTCCTCCATAGGAACCTCATCCTTGGAACGCATCGGCCAGCCAGGTATGCACTCACACCAGAGGGTCTG
GAG
CTGGCTCAGAAGCTGGCCGAGGCGGAAGGCCTGAGCACTCGGCACGCTGGCTTTAGGCCAGAGGAAC
AT
CACGGAGAGGACTCAGCAGTTCCAGAAGCCTTGTCAGAACCTGGCACCACCGAGGGGGCCGTCCAGCA
G
AGACCACTGGAGCTAAGGCCTAGCGAGTACAGAGTGCTGTTGTGTGTGGACATTGGCGAAACCAGAGGG
GCA
GGACACAGGCCAGAAATGCTCCGAGAGTTACAAAGGCTGCGTGTGCCCCACACCGTACGCAAGCTAC
AC
GTTGGAGACTTTGTGTGGGTGGCACAGGAGACCAGGCCCAGAGACCCAGAAAGACCTGGGGAGCTGGT
C
CTGGACCACATTGTGGAACGCAAGCGGCTAGATGACCTATGCAGCAGCATCATTGACGGCCGCTTTCGG
GAG
CAGAAGTTCCGCCTGAAGCGCTGTGGCCTGGGGCACCGGGTATACTTAGTGGAAGAACATGGGTCTG
TC
CACAACCTTAGCCTTCCCGAGAGCACCTTGCTGCAGGCTGTCACAAACACCCAGGTCATTGATGGCTT
T
TTTGTGAAGCGAACCATGGATATTAAGGAGTCGGCTGGCTACCTGGCGCTTTTGACAAAGGGCCTGGAA
AGA
CTGTACCAGGGCCACACCCTACGCAGCCGCCCTTGGGGGGCCCCAGGGGCTGCTGAATCAGAAGCAA
AG
CCTTCCACAAACCCTCTCTGCTCACTCCTCACCTTCAGTGACTTCAATGCAGAAGCTGTCAAGAACAA
G
GCCCAGTCTGTGCGAGAAGTATTTGCCCGGCAGCTGATGCAGGTGCGTGGACTGAGTGGGGAGAAGGCA
GCA
GCCGTGGTGGATCGATACAGCACCCCTGCCAGTCTCCTGGCTGCTTATGATGCCTGTGCCACCGCGA
AG
GAGCAGGAGATGCTCTTGAGCACCATCAAGTGTGGGCGTCTGCAGAGGAATCTGGGACCCGCTCTGAG
C
AGGACCCTGTACCAGTTGTACTGCAGCCACAGCCCTCTGAGCTGA


Translation (551 aa):
MAEPVRLGRKRPLPVCPNPLFVRWLTEWRDEAASRGRHTRFVFQKALRSLQRYPLPLRSGKEAKILQHFG
D
RLCRMLDEKLKQHLASG
GDHAPSSPSGKKGASKGPPEQVQDSSMPVPTQPQAGSTSVGYWPAQNSGARE
I
LLQLYREHL
NSDGHSFLTKEELLQKCAQKTPRVVPGSSKPWPALRSLLHRNLILGTHRPARYALTPEGL
E
LAQKLAEAEGLSTRHAGFRPEEHHGEDSAVPEALSE
PGTTEGAVQQRPLELRPSEYRVLLCVDIGETRG
A
GHRPEMLRELQRLRVPHTVRKLHVGDFVWVAQETRPRDP
ERPGELVLDHIVERKRLDDLCSSIIDGRFR
E
QK
FRLKRCGLGHRVYLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTMDIKESAGYLALLTKGLE
R
LYQ
GHTLRSRPWGAPGAAESEAKPSTNPLCSLLTFSDFNAEAVKNKAQSVREVFARQLMQVRGLSGEKA
A
AVVDRYSTPA
SLLAAYDACATAKEQEMLLSTIKCGRLQRNLGPALSRTLYQLYCSHSPLS



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser