NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS14933.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14933.1 Public Mus musculus 1 Slc40a1 16 104 75 CCDS HistoryNCBI Gene:53945Re-query CCDS DB by CCDS ID:14933.1Re-query CCDS DB by GeneID:53945

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 14933.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000027137 ENSMUSP00000027137 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027137Link to Ensembl Protein Viewer:ENSMUSP00000027137Re-query CCDS DB by Nucleotide ID:ENSMUST00000027137Re-query CCDS DB by Protein ID:ENSMUSP00000027137
Original member Current member NCBI NM_016917.2 NP_058613.2 Accepted alive Link to Nucleotide Sequence:NM_016917.2Link to Protein Sequence:NP_058613.2Re-query CCDS DB by Nucleotide ID:NM_016917Re-query CCDS DB by Protein ID:NP_058613Link to BLink:NP_058613.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_058613.2 570 Q9JHI9 570 100% 0 0

Chromosomal Locations for CCDS 14933.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

Chromosome Start Stop Links
1 45909406 45909719 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45910892 45911530 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45912236 45912481 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45918309 45918435 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45918885 45919000 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45921156 45921315 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45924717 45924784 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45925221 45925263 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1713 nt):
ATGACCAAGGCAAGAGATCAAACCCATCAGGAAGGATGCTGTGGATCCTTAGCAAACTACCTGACCTCAG
CA
AAATTCCTCCTCTACCTTGGCCACTCTCTCTCCACTTGGGGGGATCGGATGTGGCACTTTGCAGTGTC
T
GTGTTTCTGGTGGAACTCTATGGAAACAGCCTTCTCTTGACAGCTGTCTATGGACTGGTGGTGGCAGGC
TCT
GTTCTGGTCCTGGGAGCCATCATTGGTGACTGGGTGGATAAGAATGCCAGACTTAAAGTGGCCCAGA
CG
TCACTGGTGGTTCAGAATGTGTCCGTCATCCTCTGCGGAATCATCCTGATGATGGTTTTCCTACACAA
G
AATGAGCTCCTGACCATGTACCATGGATGGGTCCTTACTGTCTGCTACATCCTGATCATCACTATTGCA
AAC
ATTGCAAATTTGGCCAGTACTGCCACTGCGATCACAATCCAAAGGGACTGGATTGTTGTTGTGGCAG
GA
GAAAACAGGAGCAGATTAGCAGACATGAATGCTACCATTAGAAGGATTGACCAGCTAACCAACATCCT
G
GCCCCCATGGCTGTCGGCCAGATTATGACATTTGGTTCTCCAGTCATTGGCTGTGGTTTTATTTCCGGT
TGG
AATTTGGTGTCCATGTGTGTGGAGTACTTCTTGCTCTGGAAGGTTTACCAGAAGACCCCTGCTCTGG
CT
GTAAAAGCTGCTCTCAAGGTAGAGGAGTCAGAACTGAAGCAGCTGACCTCACCTAAAGATACTGAGCC
A
AAACCTTTGGAGGGAACTCATCTAATGGGTGAGAAAGACTCCAACATCCGTGAACTTGAATGTGAACAA
GAG
CCCACCTGTGCCTCCCAGATGGCAGAGCCCTTCCGCACTTTCCGAGATGGATGGGTCTCCTACTATA
AC
CAGCCAGTGTTTCTGGCTGGCATGGGCCTGGCTTTCCTCTATATGACAGTCCTGGGCTTTGACTGTAT
C
ACTACAGGGTACGCCTACACTCAGGGGCTGAGTGGATCCATCCTTAGTATTTTGATGGGAGCATCAGCA
ATA
ACTGGAATAATGGGAACTGTGGCCTTCACCTGGCTACGTCGAAAATGTGGCCTTGTTCGGACTGGTC
TA
TTCTCAGGACTAGCCCAGCTTTCCTGTTTAATCTTGTGTGTGATCTCCGTATTCATGCCTGGAAGCCC
C
TTGGACCTGTCTGTTTCTCCATTTGAAGATATCCGTTCTAGGTTTGTGAATGTGGAGCCAGTGTCCCCA
ACT
ACCAAAATACCTGAGACCGTCTTTACAACAGAAATGCATATGTCCAACATGTCTAATGTCCATGAGA
TG
AGTACTAAACCCATCCCCATAGTCTCTGTCAGCCTGCTGTTTGCAGGAGTCATTGCTGCTAGAATCGG
T
CTTTGGTCCTTTGATTTGACGGTGACACAGTTGCTGCAAGAAAATGTAATTGAATCTGAAAGAGGCATT
ATC
AATGGTGTGCAGAACTCCATGAACTACCTTCTTGACCTTCTGCATTTCATCATGGTCATCTTGGCCC
CA
AATCCTGAAGCTTTTGGCTTGCTGGTATTGATTTCAGTCTCCTTTGTGGCAATGGGACATCTTATGTA
T
TTCCGATTTGCCCAGAAGACTCTGGGCAACCAGATTTTTGTTTGTGGTCCTGATGAAAAAGAAGTTACA
GAT
GAAAATCAACCGAATACATCTGTTGTATAA


Translation (570 aa):
MTKARDQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAG
S
VLVLGAIIGDWVDKNARLK
VAQTSLVVQNVSVILCGIILMMVFLHKNELLTMYHGWVLTVCYILIITIA
N
IANLASTATAITIQRDWIVVVAGENRSRLA
DMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISG
W
NLVSMCVEYFLLWKVYQKTPALAVKAALKVEESELKQLTSPK
DTEPKPLEGTHLMGEKDSNIRELECEQ
E
PTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGSILSILMGASA
I
TGIMGTVAFTWLRRKCGLVRTGLFSGLAQLSCLILCVISVFMPGSPLDLSVSPFEDIRSRFVNVEPVSP
T
TKIPETVFTTEMHMSNMSNVHEMSTKPIPIVSVSLLFAGVIAARI
GLWSFDLTVTQLLQENVIESERGI
I
NGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVLISVSFVAMGHLMYFRFAQKTLGNQIFVCGPDEKEVT
D
ENQPNTSVV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser