NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24215.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24215.1 Public Mus musculus 10 Avpr1a 16 104 75 CCDS HistoryNCBI Gene:54140Re-query CCDS DB by CCDS ID:24215.1Re-query CCDS DB by GeneID:54140

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 24215.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020323 ENSMUSP00000020323 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020323Link to Ensembl Protein Viewer:ENSMUSP00000020323Re-query CCDS DB by Nucleotide ID:ENSMUST00000020323Re-query CCDS DB by Protein ID:ENSMUSP00000020323
Original member Current member EBI,WTSI OTTMUST00000049450 OTTMUSP00000022915 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049450Link to Vega Protein Viewer:OTTMUSP00000022915Re-query CCDS DB by Nucleotide ID:OTTMUST00000049450Re-query CCDS DB by Protein ID:OTTMUSP00000022915
Original member Current member NCBI NM_016847.2 NP_058543.2 Accepted alive Link to Nucleotide Sequence:NM_016847.2Link to Protein Sequence:NP_058543.2Re-query CCDS DB by Nucleotide ID:NM_016847Re-query CCDS DB by Protein ID:NP_058543Link to BLink:NP_058543.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_058543.2 423 Q62463 423 100% 0 0

Chromosomal Locations for CCDS 24215.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

Chromosome Start Stop Links
10 122448805 122449789 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 122452074 122452360 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1272 nt):
ATGAGTTTCCCGCGAGGCTCCCACGATCTGCCCGCGGGCAACTCCAGCCCGTGGTGGCCTCTGACCACCG
AG
GGCGCCAACAGCAGCCGGGAAGCAGCTGGGCTCGGGGAAGGCGGCAGCCCGCCGGGGGACGTACGCAA
C
GAGGAGCTGGCGAAGCTGGAGGTTACCGTGCTGGCGGTGATTTTCGTGGTGGCCGTGCTGGGTAATAGC
AGT
GTGCTGCTGGCGCTGCATCGCACGCCACGCAAGACATCCCGCATGCATCTCTTCATCCGACACCTCA
GC
CTGGCAGACCTGGCGGTCGCCTTCTTCCAAGTGTTACCACAGCTGTGCTGGGACATCACCTACCGCTT
C
CGCGGGCCGGACTGGCTGTGCCGGGTGGTGAAGCACTTGCAGGTGTTTGCCATGTTCGCATCTTCCTAC
ATG
CTGGTGGTGATGACGGCTGACCGCTACATCGCCGTGTGCCACCCGCTCAAGACCCTGCAGCAGCCCG
CG
CGCCGCTCGCGCCTCATGATCGCCGCCTCTTGGGGGCTGAGTTTCGTTCTGAGCATACCACAGTACTT
T
ATCTTCTCTGTGATCGAATTTGAGGTGAACAATGGCACCAAAGCCCAAGATTGCTGGGCTACCTTCATC
CCG
CCCTGGGGTACCCGTGCCTACGTGACCTGGATGACCAGCGGGGTCTTCGTGGTACCCGTGATCATCT
TG
GGTACCTGCTATGGCTTCATCTGTTACCACATCTGGCGCAATGTCCGAGGGAAGACAGCATCGCGACA
G
AGCAAAGGCGGCAAGGGCTCTGGGGAAGCCGCGGGTCCCTTCCACAAGGGGCTTCTGGTCACGCCTTGT
GTC
AGCAGCGTGAAGAGCATTTCCCGTGCCAAGATCCGCACAGTGAAGATGACCTTTGTGATTGTAAGCG
CC
TACATCCTCTGCTGGACACCTTTCTTCATCGTCCAGATGTGGTCAGTCTGGGATACCAATTTCGTTTG
G
ACCGATTCCGAAAACCCTTCCACCACGATCACGGCGTTACTGGCTTCCTTGAACAGCTGCTGCAACCCG
TGG
ATCTACATGTTTTTTAGTGGTCATCTCCTACAAGATTGTGTCCAGAGCTTCCCATGCTGCCAAAGCA
TA
GCGCAGAAATTCGCCAAGGATGACTCGGATAGCATGAGCCGGAGACAGACATCTTATTCTAACAACCG
A
AGCCCAACAAACAGCACTGGGACGTGGAAGGATTCACCTAAATCTTCAAAGTCCATCAGATTTATCCCT
GTC
TCCACTTGA


Translation (423 aa):
MSFPRGSHDLPAGNSSPWWPLTTEGANSSREAAGLGEGGSPPGDVRNEELAKLEVTVLAVIFVVAVLGNS
S
VLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVFAMFASSY
M
LVVMTADRYIAVCHPLKTLQQPARRSRLMIAASWGLSFVLSIPQYFIFSVIEFEVNNGTKAQDCWATFI
P
PWGTRAYVTWMTSGVFVVPVIILGTCYGFICYHIWRNVRGKTASRQSKGGKGSGEAAGPFHKGLLVTPC
V
SSVKSISRAKIRTVKMTFVIVSAYILCWTPFFIVQMWSVWDTNFVWT
DSENPSTTITALLASLNSCCNP
W
IYMFFSGHLLQDCVQSFPCCQSIAQKFAKDDSDSMSRRQTSYSNNRSPTNSTGTWKDSPKSSKSIRFIP
V
ST




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser