NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS20138.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20138.1 Public Mus musculus 6 Hoxa1 16 104 75 CCDS HistoryNCBI Gene:15394Re-query CCDS DB by CCDS ID:20138.1Re-query CCDS DB by GeneID:15394

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 20138.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000000964 ENSMUSP00000000964 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000000964Link to Ensembl Protein Viewer:ENSMUSP00000000964Re-query CCDS DB by Nucleotide ID:ENSMUST00000000964Re-query CCDS DB by Protein ID:ENSMUSP00000000964
Original member Current member EBI,WTSI OTTMUST00000045418 OTTMUSP00000020428 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000045418Link to Vega Protein Viewer:OTTMUSP00000020428Re-query CCDS DB by Nucleotide ID:OTTMUST00000045418Re-query CCDS DB by Protein ID:OTTMUSP00000020428
Original member Current member NCBI NM_010449.4 NP_034579.3 Accepted alive Link to Nucleotide Sequence:NM_010449.4Link to Protein Sequence:NP_034579.3Re-query CCDS DB by Nucleotide ID:NM_010449Re-query CCDS DB by Protein ID:NP_034579Link to BLink:NP_034579.3

Chromosomal Locations for CCDS 20138.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

Chromosome Start Stop Links
6 52156734 52157089 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 52157567 52158221 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1011 nt):
ATGGACAATGCAAGAATGAACTCCTTTCTGGAATACCCCATCCTTGGCAGTGGCGACTCTGGGACCTGCT
CG
GCGCGAGCTTACCCCTCTGACCATGGGATTACAACTTTCCAATCCTGCGCGGTCAGTGCCAACAGCTG
C
GGCGGCGACGACCGCTTCCTAGTGGGCAGGGGGGTGCAGATCAGCTCGCCCCACCACCACCACCACCAC
CAC
CACCATCACCACCCCCAGACGGCTACTTACCAGACTTCTGGAAACCTTGGGATTTCTTATTCCCACT
CG
AGTTGTGGTCCAAGCTATGGCGCGCAGAACTTCAGTGCGCCTTATGGCCCCTATGGATTAAATCAGGA
A
GCAGACGTAAGTGGTGGGTACCCCCCGTGCGCTCCCGCTGTTTACTCTGGAAACCTCTCGACTCCCATG
GTC
CAGCATCACCACCACCACCAGGGTTATGCTGGGGGCACAGTGGGCTCGCCCCAGTACATTCACCACT
CA
TATGGACAAGAGCAGCAGACTCTGGCCCTGGCCACGTATAATAACTCCTTATCCCCTCTCCACGCCAG
C
CACCAAGAAGCCTGTCGTTCCCCTGCTTCAGAGACGTCTTCTCCAGCGCAGACCTTTGACTGGATGAAA
GTT
AAAAGAAACCCTCCCAAAACAGGGAAAGTTGGAGAGTACGGCTACGTGGGTCAACCCAACGCAGTGC
GC
ACCAATTTCACCACCAAGCAGCTCACAGAGCTGGAGAAGGAGTTCCACTTCAACAAGTACCTTACACG
A
GCGCGCAGGGTGGAGATTGCCGCGTCCCTACAGCTCAATGAGACCCAGGTGAAGATCTGGTTCCAGAAT
CGC
CGCATGAAGCAGAAGAAGCGTGAGAAGGAGGGGCTCCTGCCCATCTCCCCTGCCACTCCTCCTGGCA
GC
GATGAGAAAACGGAAGAATCATCTGAGAAATCTAGCCCCTCGCCCAGTGCCCCTTCTCCGGCATCGTC
T
ACCTCAGACACTCTGACTACCTCCCACTGA


Translation (336 aa):
MDNARMNSFLEYPILGSGDSGTCSARAYPSDHGITTFQSCAVSANSCGGDDRFLVGRGVQISSPHHHHHH
H
HHHHPQTATYQTSGNLGISYSHSSCGPSYGAQNFSAPYGPYGLNQEADVSGGYPPCAPAVYSGNLSTPM
V
QHHHHHQGYAGGTVGSPQYIHHSYGQEQQTLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMK
V
KRNPPKT
GKVGEYGYVGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQN
R
RMKQKKREKEGLLPISPATPPGSDEKTEESSEKSSPSPSAPSPASSTSDTLTTSH




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser