NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS20573.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20573.1 Public Mus musculus 6 Fkbp4 16 104 75 CCDS HistoryNCBI Gene:14228Re-query CCDS DB by CCDS ID:20573.1Re-query CCDS DB by GeneID:14228See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 20573.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000032508 ENSMUSP00000032508 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000032508Link to Ensembl Protein Viewer:ENSMUSP00000032508Re-query CCDS DB by Nucleotide ID:ENSMUST00000032508Re-query CCDS DB by Protein ID:ENSMUSP00000032508
Original member Current member EBI,WTSI OTTMUST00000060562 OTTMUSP00000029542 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000060562Link to Vega Protein Viewer:OTTMUSP00000029542Re-query CCDS DB by Nucleotide ID:OTTMUST00000060562Re-query CCDS DB by Protein ID:OTTMUSP00000029542
Original member Current member NCBI NM_010219.3 NP_034349.1 Accepted alive Link to Nucleotide Sequence:NM_010219.3Link to Protein Sequence:NP_034349.1Re-query CCDS DB by Nucleotide ID:NM_010219Re-query CCDS DB by Protein ID:NP_034349Link to BLink:NP_034349.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034349.1 458 P30416 458 100% 0 0

Chromosomal Locations for CCDS 20573.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 128430776 128430880 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 128432422 128432661 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 128433106 128433291 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 128433526 128433609 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 128433703 128433793 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 128434305 128434461 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 128434752 128434872 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 128435714 128435856 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 128436570 128436714 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 128438406 128438510 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1377 nt):
ATGACCGCCGAGGAGATGAAGGCGGCGGAGAACGGGGCGCAGTCGGCGCCCCTGCCTCTCGAAGGAGTGG
AC
ATCAGCCCCAAACAGGACGAGGGCGTGCTCAAGGTCATCAAGAGAGAGGGTACAGGCACAGAGACACC
C
ATGATCGGGGACCGAGTCTTTGTCCACTACACTGGCTGGCTGCTAGATGGCACAAAGTTTGACTCCAGT
CTG
GACCGCAAGGACAAATTCTCCTTTGACCTGGGAAAAGGGGAGGTCATCAAGGCTTGGGATATTGCTG
TG
GCAACCATGAAAGTGGGGGAAGTGTGCCACATCACCTGCAAGCCAGAATATGCCTATGGCGCAGCAGG
C
AGCCCTCCGAAGATCCCCCCCAACGCCACACTTGTATTTGAGGTGGAGCTGTTTGAGTTCAAAGGAGAA
GAT
CTTACAGAAGAAGAAGATGGCGGGATCATCCGCAGAATACGGACTCGGGGTGAAGGCTATGCCAGGC
CC
AATGATGGTGCTATGGTGGAAGTGGCCCTGGAAGGCTACCACAAGGACCGCCTCTTTGACCAGCGGGA
G
CTCTGCTTTGAAGTCGGGGAAGGGGAAAGTCTAGATCTGCCCTGTGGGCTGGAGGAGGCCATTCAGCGC
ATG
GAGAAAGGAGAGCATTCCATCGTGTACCTCAAACCTAGCTATGCTTTTGGCAGTGTGGGGAAGGAGA
GG
TTCCAGATCCCACCGCACGCTGAGCTGAGGTATGAAGTGCGGCTGAAGAGCTTTGAGAAGGCCAAGGA
G
TCTTGGGAGATGAGCTCCGCGGAGAAGCTGGAGCAGAGCAACATAGTGAAAGAGAGGGGCACCGCGTAC
TTC
AAGGAAGGCAAGTACAAGCAGGCGTTACTGCAGTACAAGAAGATCGTGTCTTGGCTAGAATACGAGT
CT
AGCTTCTCCGGTGAGGAAATGCAAAAGGTCCATGCACTCCGACTGGCCTCACACCTCAATCTGGCCAT
G
TGTCACCTGAAACTGCAGGCCTTCTCAGCTGCCATCGAAAGCTGCAACAAGGCCTTGGAGCTGGACAGC
AAC
AACGAGAAGGGCCTGTTTCGCCGGGGAGAGGCCCACCTGGCCGTGAATGACTTTGACCTGGCAAGAG
CT
GACTTCCAAAAGGTCCTGCAGCTCTATCCCAGCAACAAAGCCGCCAAGACCCAGCTGGCTGTGTGCCA
G
CAGCGGACCCGTAGGCAGCTCGCCCGGGAAAAGAAGCTCTATGCCAACATGTTTGAGAGGCTGGCTGAG
GAG
GAGCACAAGGTGAAGGCAGAAGTGGCAGCAGGAGACCATCCCACTGATGCTGAGATGAAGGGTGAGC
GG
AACAATGTGGCCGAGAACCAGTCTCGGGTGGAGACAGAAGCGTAG


Translation (458 aa):
MTAEEMKAAENGAQSAPLPLEGVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSS
L
DRKDKFSFDLGK
GEVIKAWDIAVATMKVGEVCHITCKPEYAYGAAGSPPKIPPNATLVFEVELFEFKGE
D
LTEEEDGGIIRRIRTRGEGYARPNDGAMVE
VALEGYHKDRLFDQRELCFEVGEGESLDLPCGLEEAIQR
M
EKGEHSIVYLKP
SYAFGSVGKERFQIPPHAELRYEVRLKSFEKAKESWEMSSAEKLEQSNIVKERGTAY
F
K
EGKYKQALLQYKKIVSWLEYESSFSGEEMQKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDS
N
NEKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKTQLAVCQQRTRRQLAREKKLYANMFERLAE
E
EHK
VKAEVAAGDHPTDAEMKGERNNVAENQSRVETEA



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser