NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21465.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21465.1 Public Mus musculus 7 Capn5 16 104 75 CCDS HistoryNCBI Gene:12337Re-query CCDS DB by CCDS ID:21465.1Re-query CCDS DB by GeneID:12337See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 21465.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000040971 ENSMUSP00000048183 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000040971Link to Ensembl Protein Viewer:ENSMUSP00000048183Re-query CCDS DB by Nucleotide ID:ENSMUST00000040971Re-query CCDS DB by Protein ID:ENSMUSP00000048183
Original member Current member EBI,WTSI ENSMUST00000107112 ENSMUSP00000102729 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107112Link to Ensembl Protein Viewer:ENSMUSP00000102729Re-query CCDS DB by Nucleotide ID:ENSMUST00000107112Re-query CCDS DB by Protein ID:ENSMUSP00000102729
Original member Current member EBI,WTSI OTTMUST00000053964 OTTMUSP00000025702 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000053964Link to Vega Protein Viewer:OTTMUSP00000025702Re-query CCDS DB by Nucleotide ID:OTTMUST00000053964Re-query CCDS DB by Protein ID:OTTMUSP00000025702
Original member Current member EBI,WTSI OTTMUST00000053965 OTTMUSP00000025703 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000053965Link to Vega Protein Viewer:OTTMUSP00000025703Re-query CCDS DB by Nucleotide ID:OTTMUST00000053965Re-query CCDS DB by Protein ID:OTTMUSP00000025703
Original member NCBI NM_007602.3 NP_031628.1 Updated not alive Link to Nucleotide Sequence:NM_007602.3Link to Protein Sequence:NP_031628.1Re-query CCDS DB by Nucleotide ID:NM_007602Re-query CCDS DB by Protein ID:NP_031628
Current member NCBI NM_007602.4 NP_031628.1 Accepted alive Link to Nucleotide Sequence:NM_007602.4Link to Protein Sequence:NP_031628.1Re-query CCDS DB by Nucleotide ID:NM_007602Re-query CCDS DB by Protein ID:NP_031628Link to BLink:NP_031628.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031628.1 640 O08688 640 100% 0 0

Chromosomal Locations for CCDS 21465.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 98123873 98124055 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98125242 98125378 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98125829 98125944 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98126246 98126442 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98128473 98128595 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98129244 98129439 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98131191 98131268 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98131676 98131869 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98132833 98133025 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98135760 98135968 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98151812 98151943 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98161916 98162080 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1923 nt):
ATGTTCTCCTGCGCGAAGGCCTATGAGGACCAGAACTACTCGGCGCTGAAGCGGGCCTGCCTGCGCAAGA
AG
GTGCTGTTCGAGGATCCCCTCTTCCCTGCCACCGACGACTCCCTTTACTATAAGGGCACCCCAGGGCC
C
ACAGTCAGGTGGAAGCGGCCTAAGGATATCTGCGACGATCCCCGGCTCTTCGTAGATGGCATCAGCTCC
CAT
GACCTGCACCAGGGCCAGGTGGGCAACTGCTGGTTTGTGGCTGCCTGCTCATCACTGGCCTCCCGAG
AG
TCACTCTGGCAGAAGGTCATCCCAGACTGGAAGGAGCAGGAATGGAACCCCGAGAAGCCTGACAGCTA
T
GCTGGCATCTTCCACTTCAACTTCTGGCGCTTTGGGGAGTGGGTGGACGTAATCGTCGATGACCGGCTG
CCC
ACAGTCAACAACCAGCTCATTTACTGCCATTCCAACTCCAAAAATGAGTTCTGGTGTGCCCTGGTGG
AG
AAGGCCTATGCCAAGCTGGCCGGCTGTTACCAGGCCCTGGACGGAGGCAACACGGCCGATGCATTGGT
G
GATTTCACAGGTGGTGTTTCTGAACCCATTGACCTGACCGAGGGGGACTTGGCCACTGACGAGGCTAAG
AGG
AATCAGCTCTTTGAGCGAGTGCTGAAGGTGCACAGCAGAGGCGGGCTCATCAGTGCCTCCATCAAGG
CT
GTGACAGCAGCTGACATGGAGGCCCGCCTGGCATGTGGCCTGGTGAAGGGCCATGCATACGCTGTCAC
C
GATGTGCGCAAGGTGCGCCTGGGCCATGGCCTGCTGGCCTTCTTCAAGTCAGAGAAGCTTGATATGATC
CGT
CTGAGGAACCCCTGGGGCGAGCGGGAGTGGACGGGGCCCTGGAGTGACACGTCAGAGGAATGGCAGA
AA
GTGAGCAAGAGTGAGAGGGAGAAGATGGGCGTGACCGTGCAGGATGATGGGGAATTCTGGATGACCTT
T
GAGGACATGTGCCGGTACTTTACTGACATCATTAAATGCCGCCTGATTAACACGTCCTACCTGAGCATC
CAT
AAGACATGGGAGGAGGCCCGGCTGCATGGTGCCTGGACGAGACATGAGGACCCACAGCAGAACCGCA
GT
GGAGGCTGCATCAACCACAAGGACACTTTCTTCCAGAACCCACAGTACGTATTTGAAGTCAAGAAGCC
A
GAAGATGAAGTGTTGATCAGTATCCAGCAGCGGCCGAAGCGCTCAACTCGCCGGGAGGGCAAAGGCGAG
AAT
CTGGCCATTGGCTTCGACATCTATAAGGTGGAAGAGAACCGCCAATACCGTATGCACAGCCTACAGC
AT
AAGGCCGCCAGCTCCATCTACATCAATTCCCGCAGCGTTTTTTTGAGGACAGAGCTGCCCGAGGGCCG
C
TACGTTATCATCCCTACCACCTTTGAGCCAGGCCACACTGGCGAGTTCCTGCTCCGAGTCTTCACAGAT
GTC
CCCTCCAACTGCCGGGAACTACGCCTGGATGAGCCCCCTCGGACCTGTTGGAGTTCCCTCTGTGGCT
AC
CCTCAGCAGGTGGCCCAGGTACATGTCCTGGGGGCTGCTGGCCTCAAGGACTCCCCAACAGGAGCAAA
C
TCATATGTGATCATCAAGTGTGAGGGCGAAAAGGTTCGCTCAGCTGTGCAGAGAGGGACCTCGACACCA
GAG
TACAATGTAAAAGGCATCTTCTATCGCAAGAAGCTGGCTCAGCCTATCACCGTGCAGGTTTGGAATC
AC
CGAGTCCTGAAGGATGAATTCCTGGGCCAGGTGCACCTGAAGACTGCCCCGGATGACCTGCAGGACCT
C
CACACCCTCCATCTCCAGGACCGCAGTAGCCGGCAGCCCAGTGACCTGCCAGGCATTGTAGCTGTGCGA
GTC
CTCTGCAGTGCCTCTCTCACGGCTGTCTGA


Translation (640 aa):
MFSCAKAYEDQNYSALKRACLRKKVLFEDPLFPATDDSLYYKGTPGPTVRWKRPKDICDDPRLFVDGISS
H
DLHQGQVGNCWFVAACSSLASRESLWQK
VIPDWKEQEWNPEKPDSYAGIFHFNFWRFGEWVDVIVDDRL
P
TVNNQLIYCHSNSKNEFWCALVEKAYA
KLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDLATDEAK
R
NQLFERVLKVHSRGGLISASIK
AVTAADMEARLACGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLDMI
R
LRNPWGEREWTGPWSD
TSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDMCRYFTDIIKCRLINTSYLSI
H
KTWEEARLHGAWTRHEDPQQNRSGGCINHKDTFFQNPQ
YVFEVKKPEDEVLISIQQRPKRSTRREGKGE
N
LAIGFDIYK
VEENRQYRMHSLQHKAASSIYINSRSVFLRTELPEGRYVIIPTTFEPGHTGEFLLRVFTD
V
PSNC
RELRLDEPPRTCWSSLCGYPQQVAQVHVLGAAGLKDSPTGANSYVIIKCEGEKVRSAVQRGTSTP
E
YNVKGIFYRKKLAQPITVQ
VWNHRVLKDEFLGQVHLKTAPDDLQDLHTLHLQDRSSRQPSDLPGIVAVR
V
LCSASLTAV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser