NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23615.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23615.1 Public Mus musculus 9 Acvr2b 16 104 75 CCDS HistoryNCBI Gene:11481Re-query CCDS DB by CCDS ID:23615.1Re-query CCDS DB by GeneID:11481See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 23615.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000165044 ENSMUSP00000126108 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000165044Link to Ensembl Protein Viewer:ENSMUSP00000126108Re-query CCDS DB by Nucleotide ID:ENSMUST00000165044Re-query CCDS DB by Protein ID:ENSMUSP00000126108
Original member Current member NCBI NM_007397.2 NP_031423.1 Accepted alive Link to Nucleotide Sequence:NM_007397.2Link to Protein Sequence:NP_031423.1Re-query CCDS DB by Nucleotide ID:NM_007397Re-query CCDS DB by Protein ID:NP_031423Link to BLink:NP_031423.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031423.1 536 P27040-1 536 100% 0 0

Chromosomal Locations for CCDS 23615.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 119402546 119402597 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 119427455 119427662 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 119427967 119428076 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 119428201 119428568 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 119429865 119430008 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 119430220 119430368 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 119431224 119431338 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 119432489 119432627 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 119432713 119432843 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 119433267 119433461 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1611 nt):
ATGACGGCGCCCTGGGCGGCCCTCGCCCTTCTCTGGGGATCGCTGTGCGCCGGTTCCGGGCGAGGGGAGG
CT
GAGACTCGGGAGTGCATCTACTACAACGCCAACTGGGAGCTGGAGCGCACCAACCAGAGCGGCCTGGA
G
CGCTGCGAGGGGGAACAGGACAAGCGGCTGCACTGCTACGCCTCGTGGCGCAACAGCTCGGGCACCATC
GAG
CTGGTGAAGAAGGGCTGCTGGCTAGATGACTTCAATTGCTACGACAGGCAGGAGTGTGTGGCCACCG
AG
GAGAACCCCCAGGTGTACTTCTGCTGCTGCGAAGGCAACTTCTGCAACGAGCGCTTCACCCACTTGCC
G
GAGCCTGGGGGCCCAGAAGTCACGTACGAGCCACCCCCGACAGCCCCCACCCTGCTCACGGTGCTGGCC
TAC
TCGCTGCTGCCCATTGGAGGCCTCTCTCTCATCGTCCTGCTGGCCTTCTGGATGTATCGTCATCGGA
AG
CCTCCCTACGGCCATGTGGACATCCATGAGGTGAGACAGTGCCAGCGTTGGGCAGGGAGAAGGGACGG
C
TGTGCGGACTCCTTTAAGCCCTTGCCTTTCCAGGACCCGGGGCCTCCGCCCCCATCCCCTCTGGTGGGC
CTG
AAGCCACTACAGCTGCTGGAGATCAAGGCTCGGGGCCGCTTTGGCTGCGTTTGGAAAGCTCAGCTCA
TG
AACGACTTTGTGGCTGTGAAGATCTTCCCACTTCAGGACAAGCAGTCGTGGCAGAGTGAACGGGAAAT
C
TTCAGCACACCCGGCATGAAGCACGAAAACTTGTTGCAGTTCATTGCTGCCGAGAAACGAGGCTCCAAC
CTG
GAGGTGGAGCTGTGGCTCATCACAGCCTTCCACGACAAGGGCTCCCTCACGGATTACCTCAAGGGGA
AC
ATCATCACGTGGAACGAACTGTGCCACGTGGCGGAGACGATGTCACGAGGCCTCTCATACCTGCATGA
G
GATGTGCCGTGGTGTCGTGGTGAGGGCCACAAGCCTTCTATTGCCCACAGGGACTTCAAAAGCAAGAAT
GTA
CTGCTGAAGAGCGACCTCACCGCGGTGCTGGCTGACTTCGGCCTGGCTGTTCGGTTTGAGCCAGGGA
AG
CCTCCTGGGGATACCCATGGACAGGTTGGCACCAGACGGTACATGGCCCCTGAGGTGCTGGAAGGAGC
C
ATCAACTTCCAGAGAGACGCCTTCCTGCGTATCGACATGTACGCCATGGGCCTGGTGCTGTGGGAGCTC
GTC
TCTCGGTGCAAGGCTGCAGACGGGCCTGTCGATGAGTACATGCTGCCCTTCGAGGAGGAGATTGGCC
AG
CACCCTTCGCTGGAGGAGCTTCAGGAGGTGGTTGTCCACAAGAAGATGAGGCCCACGATTAAGGATCA
C
TGGCTGAAACACCCGGGCCTGGCCCAGCTCTGCGTGACCATCGAGGAGTGCTGGGACCATGATGCAGAG
GCT
CGCCTTTCTGCAGGCTGTGTAGAAGAGCGGGTATCCCTGATCAGGAGGTCGGTCAACGGCACTACCT
CG
GACTGTCTCGTCTCTCTGGTGACCTCCGTCACCAATGTGGACCTGCTCCCTAAAGAGTCCAGCATCTA
A


Translation (536 aa):
MTAPWAALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTI
E
LVKKGCWLDDFNCYD
RQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPTLLTVLA
Y
SLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHEVRQCQRWAGRRDGCADSFKPLPFQDPGPPPPSPLVG
L
KPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQ
DKQSWQSEREIFSTPGMKHENLLQFIAAEKRGSN
L
EVELWLITAFHDK
GSLTDYLKGNIITWNELCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKN
V
LLKSDLTAVLADFGLAVRFEPGKPPGDTHGQ
VGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWEL
V
SRCKAAD
GPVDEYMLPFEEEIGQHPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAE
A
RLSAGCVEERVSLIRRSVNGTTSDCLVSLVTSVTNVDLLPKESSI




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser