NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS57528.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57528.1 Public Mus musculus 7 Axl 16 104 75 CCDS HistoryNCBI Gene:26362Re-query CCDS DB by CCDS ID:57528.1Re-query CCDS DB by GeneID:26362

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Sequence IDs included in CCDS 57528.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000085948 ENSMUSP00000083110 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000085948Link to Ensembl Protein Viewer:ENSMUSP00000083110Re-query CCDS DB by Nucleotide ID:ENSMUST00000085948Re-query CCDS DB by Protein ID:ENSMUSP00000083110
Original member Current member EBI,WTSI OTTMUST00000053094 OTTMUSP00000025230 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000053094Link to Vega Protein Viewer:OTTMUSP00000025230Re-query CCDS DB by Nucleotide ID:OTTMUST00000053094Re-query CCDS DB by Protein ID:OTTMUSP00000025230
Original member Current member NCBI NM_001190974.1 NP_001177903.1 Accepted alive Link to Nucleotide Sequence:NM_001190974.1Link to Protein Sequence:NP_001177903.1Re-query CCDS DB by Nucleotide ID:NM_001190974Re-query CCDS DB by Protein ID:NP_001177903Link to BLink:NP_001177903.1

Chromosomal Locations for CCDS 57528.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

Chromosome Start Stop Links
7 25758662 25759013 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25760751 25760887 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25761405 25761564 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25763284 25763393 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25763943 25764064 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25764422 25764514 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25766518 25766595 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25766793 25766888 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25770218 25770309 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25770633 25770765 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25773343 25773493 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25774084 25774223 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25774515 25774725 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25778370 25778485 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25778624 25778704 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25785834 25786010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25786887 25786987 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25787291 25787516 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25788415 25788478 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2640 nt):
ATGGGCAGGGTCCCGCTGGCCTGGTGGTTGGCGCTGTGCTGCTGGGGGTGTGCAGCCCATAAGGACACAC
AG
ACCGAGGCTGGCAGCCCGTTTGTGGGGAACCCAGGGAATATCACAGGTGCCAGAGGACTCACGGGGAC
A
CTTCGGTGTGAGCTCCAGGTTCAGGGGGAACCCCCTGAGGTGGTGTGGCTTCGAGATGGACAGATCCTA
GAA
CTGGCTGATAACACCCAGACCCAGGTGCCTCTGGGCGAAGACTGGCAAGATGAATGGAAAGTTGTCA
GT
CAGCTCAGAATCTCAGCCCTGCAACTTTCAGATGCAGGGGAGTACCAGTGTATGGTGCATCTAGAAGG
A
CGGACCTTTGTGTCTCAGCCGGGCTTTGTAGGGCTGGAAGGTCTCCCGTACTTCCTGGAGGAGCCTGAG
GAC
AAAGCTGTGCCTGCCAACACCCCTTTCAACCTAAGCTGCCAGGCCCAGGGACCCCCGGAACCCGTGA
CC
CTACTCTGGCTTCAAGATGCTGTCCCCCTGGCCCCAGTCACAGGACACAGCTCCCAGCACAGTCTGCA
A
ACTCCAGGCCTGAACAAGACATCTTCTTTCTCATGTGAAGCCCACAATGCCAAGGGAGTCACCACCTCC
CGC
ACAGCCACCATCACAGTGCTCCCCCAGAGGCCTCACCATCTCCACGTGGTTTCCAGACAACCTACGG
AG
CTAGAGGTAGCTTGGACCCCTGGCCTGAGTGGCATCTACCCGCTCACCCACTGCAACCTGCAGGCCGT
G
CTGTCAGACGATGGGGTGGGTATCTGGCTGGGAAAGTCAGATCCTCCTGAAGACCCCCTCACCTTGCAA
GTA
TCAGTGCCCCCCCACCAGCTTCGGCTGGAAAAGCTCCTTCCTCACACCCCGTATCACATCCGGATAT
CC
TGCAGCAGCAGCCAGGGCCCCTCACCTTGGACCCACTGGCTTCCTGTGGAGACCACAGAGGGAGTGCC
C
TTGGGTCCCCCTGAGAACGTTAGCGCCATGCGGAATGGGAGCCAGGTCCTCGTGCGTTGGCAGGAGCCA
AGG
GTGCCCCTGCAAGGCACCCTGTTAGGGTACCGGCTGGCATATCGAGGCCAGGACACCCCCGAGGTAC
TT
ATGGATATAGGGCTAACTCGAGAGGTGACCTTGGAACTGCGGGGGGACAGGCCTGTGGCTAACCTGAC
T
GTGTCTGTGACAGCCTATACCTCGGCTGGGGATGGGCCCTGGAGCCTTCCTGTGCCCCTAGAGCCCTGG
CGC
CCAGTGAGTGAACCCCCACCTCGCGCCTTCTCGTGGCCTTGGTGGTATGTACTGCTGGGAGCACTTG
TG
GCTGCCGCCTGCGTCCTCATCTTGGCCCTGTTCCTTGTCCATCGGAGGAAGAAGGAGACTCGATATGG
G
GAGGTGTTTGAGCCAACCGTGGAAAGAGGTGAACTGGTAGTCAGGTACCGTGTCCGAAAGTCCTACAGC
CGG
CGGACCACTGAAGCCACCTTGAACAGTCTGGGCATCAGTGAAGAGCTGAAGGAGAAACTACGAGACG
TC
ATGGTAGATCGGCATAAGGTGGCCTTGGGGAAGACCCTGGGAGAAGGAGAATTTGGCGCTGTGATGGA
A
GGTCAGCTCAATCAGGATGACTCCATCCTCAAGGTCGCTGTGAAGACCATGAAAATTGCCATCTGCACA
AGA
TCAGAGCTGGAGGATTTCCTGAGTGAAGCTGTCTGCATGAAGGAATTTGACCACCCCAACGTCATGA
GG
CTCATTGGCGTCTGTTTTCAGGGCTCTGACAGAGAGGGTTTCCCAGAACCTGTGGTCATCTTGCCTTT
C
ATGAAACACGGAGACCTACACAGTTTCCTCCTGTACTCCCGGCTCGGGGACCAGCCAGTGTTCCTGCCC
ACT
CAGATGCTAGTGAAGTTCATGGCCGACATTGCCAGTGGTATGGAGTACCTGAGTACCAAGAGATTCA
TA
CATCGGGACCTGGCTGCCAGGAACTGCATGCTGAATGAGAACATGTCCGTGTGTGTGGCAGACTTCGG
G
CTCTCCAAGAAGATCTACAACGGGGATTACTACCGCCAAGGGCGCATTGCCAAGATGCCAGTCAAGTGG
ATT
GCTATTGAGAGTCTGGCAGATCGGGTCTACACCAGCAAGAGCGATGTGTGGTCCTTCGGTGTGACAA
TG
TGGGAGATCGCCACCCGAGGCCAAACTCCCTATCCAGGGGTGGAGAACAGTGAGATTTACGACTACCT
G
CGTCAAGGAAATCGGCTGAAACAGCCTGTGGACTGTCTGGACGGCCTGTATGCCCTGATGTCTCGGTGC
TGG
GAACTGAACCCTCGAGACCGGCCAAGTTTTGCGGAGCTCCGGGAAGACTTGGAGAACACACTGAAGG
CT
CTGCCCCCTGCTCAGGAGCCAGATGAAATCCTCTATGTCAACATGGATGAGGGCGGAAGCCACCTTGA
A
CCCCGTGGGGCTGCTGGAGGAGCTGACCCCCCAACCCAACCTGATCCTAAGGATTCCTGTAGCTGTCTC
ACT
GCAGCTGACGTCCACTCAGCTGGACGCTATGTCCTTTGTCCTTCTACAGCCCCAGGACCCACTCTGT
CT
GCTGACAGAGGCTGCCCAGCACCTCCAGGGCAGGAGGACGGAGCCTGA


Translation (879 aa):
MGRVPLAWWLALCCWGCAAHKDTQTEAGSPFVGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQIL
E
LADNTQTQVPLGEDWQDEWKVVSQL
RISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPE
D
KAVPANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHSLQTP
GLNKTSSFSCEAHNAKGVTTS
R
TATIT
VLPQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQ
V
SVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEG
VPLGPPENVSAMRNGSQVLVRWQEP
R
VPLQGTLLGYRLAYRGQDTPE
VLMDIGLTREVTLELRGDRPVANLTVSVTAYTSAGDGPWSLPVPLEPW
R
P
VSEPPPRAFSWPWWYVLLGALVAAACVLILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYS
R
RTTEAT
LNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICT
R
SELEDFLSEAVCMKEFDHPNVMRLI
GVCFQGSDREGFPEPVVILPFMKHGDLHSFLLYSRLGDQPVFLP
T
QMLVKFMADIASGMEYLSTKRFIHRDLAARNC
MLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMPVKW
I
AIESLADRVYTSKSDV
WSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPVDCLDGLYALMSRC
W
ELNPRDRPSFAELREDLENTLKALPPAQEPDEILYVNMDEGGSHLEPRGAAGGADPPTQPDPKDSCSCL
T
AADVHSAGRYVLCPSTAPGPTLSADRGCPAPPGQEDGA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser