NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28381.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28381.1 Public Mus musculus 17 Ccr6 19 105 81 CCDS HistoryNCBI Gene:12458Re-query CCDS DB by CCDS ID:28381.1Re-query CCDS DB by GeneID:12458See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 28381.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000097418 ENSMUSP00000095029 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000097418Link to Ensembl Protein Viewer:ENSMUSP00000095029Re-query CCDS DB by Nucleotide ID:ENSMUST00000097418Re-query CCDS DB by Protein ID:ENSMUSP00000095029
Original member Current member EBI,WTSI ENSMUST00000167956 ENSMUSP00000128529 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000167956Link to Ensembl Protein Viewer:ENSMUSP00000128529Re-query CCDS DB by Nucleotide ID:ENSMUST00000167956Re-query CCDS DB by Protein ID:ENSMUSP00000128529
Original member Current member EBI,WTSI ENSMUST00000166348 ENSMUSP00000128559 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000166348Link to Ensembl Protein Viewer:ENSMUSP00000128559Re-query CCDS DB by Nucleotide ID:ENSMUST00000166348Re-query CCDS DB by Protein ID:ENSMUSP00000128559
Original member Current member EBI,WTSI ENSMUST00000164411 ENSMUSP00000131153 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000164411Link to Ensembl Protein Viewer:ENSMUSP00000131153Re-query CCDS DB by Nucleotide ID:ENSMUST00000164411Re-query CCDS DB by Protein ID:ENSMUSP00000131153
Original member Current member EBI,WTSI ENSMUST00000180103 ENSMUSP00000135945 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000180103Link to Ensembl Protein Viewer:ENSMUSP00000135945Re-query CCDS DB by Nucleotide ID:ENSMUST00000180103Re-query CCDS DB by Protein ID:ENSMUSP00000135945
Original member Current member EBI,WTSI ENSMUST00000177568 ENSMUSP00000137249 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000177568Link to Ensembl Protein Viewer:ENSMUSP00000137249Re-query CCDS DB by Nucleotide ID:ENSMUST00000177568Re-query CCDS DB by Protein ID:ENSMUSP00000137249
Original member Current member NCBI NM_001190333.1 NP_001177262.1 Accepted alive Link to Nucleotide Sequence:NM_001190333.1Link to Protein Sequence:NP_001177262.1Re-query CCDS DB by Nucleotide ID:NM_001190333Re-query CCDS DB by Protein ID:NP_001177262Link to BLink:NP_001177262.1
Original member Current member NCBI NM_001190334.1 NP_001177263.1 Accepted alive Link to Nucleotide Sequence:NM_001190334.1Link to Protein Sequence:NP_001177263.1Re-query CCDS DB by Nucleotide ID:NM_001190334Re-query CCDS DB by Protein ID:NP_001177263Link to BLink:NP_001177263.1
Original member Current member NCBI NM_001190335.1 NP_001177264.1 Accepted alive Link to Nucleotide Sequence:NM_001190335.1Link to Protein Sequence:NP_001177264.1Re-query CCDS DB by Nucleotide ID:NM_001190335Re-query CCDS DB by Protein ID:NP_001177264Link to BLink:NP_001177264.1
Original member Current member NCBI NM_001190336.1 NP_001177265.1 Accepted alive Link to Nucleotide Sequence:NM_001190336.1Link to Protein Sequence:NP_001177265.1Re-query CCDS DB by Nucleotide ID:NM_001190336Re-query CCDS DB by Protein ID:NP_001177265Link to BLink:NP_001177265.1
Original member Current member NCBI NM_001190337.1 NP_001177266.1 Accepted alive Link to Nucleotide Sequence:NM_001190337.1Link to Protein Sequence:NP_001177266.1Re-query CCDS DB by Nucleotide ID:NM_001190337Re-query CCDS DB by Protein ID:NP_001177266Link to BLink:NP_001177266.1
Original member Current member NCBI NM_009835.4 NP_033965.1 Accepted alive Link to Nucleotide Sequence:NM_009835.4Link to Protein Sequence:NP_033965.1Re-query CCDS DB by Nucleotide ID:NM_009835Re-query CCDS DB by Protein ID:NP_033965Link to BLink:NP_033965.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001177262.1 367 O54689 367 100% 0 0
NP_001177263.1 367 O54689 367 100% 0 0
NP_001177264.1 367 O54689 367 100% 0 0
NP_001177265.1 367 O54689 367 100% 0 0
NP_001177266.1 367 O54689 367 100% 0 0
NP_033965.1 367 O54689 367 100% 0 0

Chromosomal Locations for CCDS 28381.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 8255965 8257068 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1104 nt):
ATGAATTCCACAGAGTCCTACTTTGGAACGGATGATTATGACAACACAGAGTATTATTCTATTCCTCCAG
AC
CATGGGCCATGCTCCCTAGAAGAGGTCAGAAACTTCACCAAGGTATTTGTGCCAATTGCCTACTCCTT
A
ATATGTGTCTTTGGCCTCCTGGGCAACATTATGGTGGTGATGACCTTTGCCTTCTACAAGAAAGCCAGA
TCC
ATGACTGACGTCTACCTGTTGAACATGGCCATCACAGACATACTCTTTGTCCTCACCCTACCGTTCT
GG
GCAGTTACTCATGCCACCAACACTTGGGTTTTCAGCGATGCACTGTGTAAACTGATGAAAGGCACATA
T
GCGGTCAACTTTAACTGTGGGATGCTGCTCCTGGCCTGTATCAGCATGGACCGGTACATTGCCATCGTC
CAG
GCAACCAAATCTTTCCGGGTACGCTCCAGAACACTGACGCACAGTAAGGTCATCTGTGTGGCAGTGT
GG
TTCATCTCCATCATCATCTCAAGCCCTACATTTATCTTCAACAAGAAATACGAGCTGCAGGATCGTGA
T
GTCTGTGAGCCACGGTACAGGTCTGTCTCAGAGCCCATCACGTGGAAGCTGCTGGGTATGGGACTGGAG
CTG
TTCTTTGGGTTCTTCACCCCTTTGCTGTTTATGGTGTTCTGCTATCTGTTCATTATCAAGACCTTGG
TG
CAGGCCCAGAACTCCAAGAGGCACAGAGCAATCCGAGTCGTGATCGCTGTGGTTCTCGTGTTCCTGGC
T
TGTCAGATCCCTCACAACATGGTCCTCCTCGTGACTGCGGTCAACACGGGCAAAGTGGGCCGGAGCTGC
AGC
ACCGAGAAAGTCCTCGCCTACACCAGGAACGTGGCCGAGGTCCTGGCTTTCCTGCATTGCTGCCTCA
AC
CCCGTGTTGTATGCGTTTATTGGACAGAAATTCAGAAACTACTTCATGAAGATCATGAAGGATGTGTG
G
TGTATGAGAAGGAAGAATAAGATGCCTGGCTTCCTCTGTGCCCGGGTTTACTCGGAAAGCTACATCTCC
AGG
CAGACCAGTGAGACCGTCGAAAATGATAATGCATCGTCCTTTACCATGTAA


Translation (367 aa):
MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAYSLICVFGLLGNIMVVMTFAFYKKAR
S
MTDVYLLNMAITDILFVLTLPFWAVTHATNTWVFSDALCKLMKGTYAVNFNCGMLLLACISMDRYIAIV
Q
ATKSFRVRSRTLTHSKVICVAVWFISIIISSPTFIFNKKYELQDRDVCEPRYRSVSEPITWKLLGMGLE
L
FFGFFTPLLFMVFCYLFIIKTLVQAQNSKRHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSC
S
TEKVLAYTRNVAEVLAFLHCCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLCARVYSESYIS
R
QTSETVENDNASSFTM




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser