NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27034.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27034.1 Public Mus musculus 14 Ang 16 104 75 CCDS HistoryNCBI Gene:11727Re-query CCDS DB by CCDS ID:27034.1Re-query CCDS DB by GeneID:11727

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27034.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000069011 ENSMUSP00000067434 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000069011Link to Ensembl Protein Viewer:ENSMUSP00000067434Re-query CCDS DB by Nucleotide ID:ENSMUST00000069011Re-query CCDS DB by Protein ID:ENSMUSP00000067434
Original member Current member EBI,WTSI ENSMUST00000171688 ENSMUSP00000132084 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000171688Link to Ensembl Protein Viewer:ENSMUSP00000132084Re-query CCDS DB by Nucleotide ID:ENSMUST00000171688Re-query CCDS DB by Protein ID:ENSMUSP00000132084
Original member Current member NCBI NM_001161731.2 NP_001155203.1 Accepted alive Link to Nucleotide Sequence:NM_001161731.2Link to Protein Sequence:NP_001155203.1Re-query CCDS DB by Nucleotide ID:NM_001161731Re-query CCDS DB by Protein ID:NP_001155203Link to BLink:NP_001155203.1
Original member Current member NCBI NM_007447.3 NP_031473.1 Accepted alive Link to Nucleotide Sequence:NM_007447.3Link to Protein Sequence:NP_031473.1Re-query CCDS DB by Nucleotide ID:NM_007447Re-query CCDS DB by Protein ID:NP_031473Link to BLink:NP_031473.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001155203.1 145 P21570 145 100% 0 0
NP_031473.1 145 P21570 145 100% 0 0

Chromosomal Locations for CCDS 27034.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

Chromosome Start Stop Links
14 51101404 51101841 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (438 nt):
ATGGCGATAAGCCCAGGCCCGTTGTTCTTGATCTTCGTGCTGGGTCTGGTTGTGATCCCTCCCACTCTGG
CT
CAGGATGACTCCAGGTACACAAAATTCCTGACTCAGCACCATGACGCCAAGCCAAAGGGCCGGGACGA
C
AGATACTGTGAACGTATGATGAAGAGAAGAAGCCTAACCTCACCCTGCAAAGATGTCAACACCTTTATC
CAT
GGCAACAAGAGCAACATCAAGGCCATCTGTGGAGCGAATGGAAGCCCTTACAGAGAAAACTTAAGAA
TG
AGCAAGTCTCCCTTCCAGGTCACCACTTGCAAGCACACAGGAGGGTCTCCCCGACCTCCATGCCAGTA
C
CGAGCCTCTGCAGGGTTCAGACATGTTGTTATTGCCTGTGAGAATGGTTTGCCTGTCCACTTCGATGAG
TCG
TTTTTCAGTCTATAG


Translation (145 aa):
MAISPGPLFLIFVLGLVVIPPTLAQDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFI
H
GNKSNIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFRHVVIACENGLPVHFDE
S
FFSL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser