NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22509.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22509.1 Public Mus musculus 8 Adcy7 16 104 75 CCDS HistoryNCBI Gene:11513Re-query CCDS DB by CCDS ID:22509.1Re-query CCDS DB by GeneID:11513

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 22509.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000098521 ENSMUSP00000096122 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000098521Link to Ensembl Protein Viewer:ENSMUSP00000096122Re-query CCDS DB by Nucleotide ID:ENSMUST00000098521Re-query CCDS DB by Protein ID:ENSMUSP00000096122
Original member Current member EBI,WTSI ENSMUST00000168545 ENSMUSP00000129252 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000168545Link to Ensembl Protein Viewer:ENSMUSP00000129252Re-query CCDS DB by Nucleotide ID:ENSMUST00000168545Re-query CCDS DB by Protein ID:ENSMUSP00000129252
Original member Current member EBI,WTSI ENSMUST00000169037 ENSMUSP00000130594 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000169037Link to Ensembl Protein Viewer:ENSMUSP00000130594Re-query CCDS DB by Nucleotide ID:ENSMUST00000169037Re-query CCDS DB by Protein ID:ENSMUSP00000130594
Original member Current member EBI,WTSI ENSMUST00000171456 ENSMUSP00000132528 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000171456Link to Ensembl Protein Viewer:ENSMUSP00000132528Re-query CCDS DB by Nucleotide ID:ENSMUST00000171456Re-query CCDS DB by Protein ID:ENSMUSP00000132528
Original member Current member NCBI NM_001037723.3 NP_001032812.2 Accepted alive Link to Nucleotide Sequence:NM_001037723.3Link to Protein Sequence:NP_001032812.2Re-query CCDS DB by Nucleotide ID:NM_001037723Re-query CCDS DB by Protein ID:NP_001032812Link to BLink:NP_001032812.2
Original member Current member NCBI NM_001037724.4 NP_001032813.1 Accepted alive Link to Nucleotide Sequence:NM_001037724.4Link to Protein Sequence:NP_001032813.1Re-query CCDS DB by Nucleotide ID:NM_001037724Re-query CCDS DB by Protein ID:NP_001032813Link to BLink:NP_001032813.1
Original member Current member NCBI NM_001109756.1 NP_001103226.1 Accepted alive Link to Nucleotide Sequence:NM_001109756.1Link to Protein Sequence:NP_001103226.1Re-query CCDS DB by Nucleotide ID:NM_001109756Re-query CCDS DB by Protein ID:NP_001103226Link to BLink:NP_001103226.1
Original member Current member NCBI NM_007406.2 NP_031432.2 Accepted alive Link to Nucleotide Sequence:NM_007406.2Link to Protein Sequence:NP_031432.2Re-query CCDS DB by Nucleotide ID:NM_007406Re-query CCDS DB by Protein ID:NP_031432Link to BLink:NP_031432.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001032812.2 1099 P51829 1099 100% 0 0
NP_001032813.1 1099 P51829 1099 100% 0 0
NP_001103226.1 1099 P51829 1099 100% 0 0
NP_031432.2 1099 P51829 1099 100% 0 0

Chromosomal Locations for CCDS 22509.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

Chromosome Start Stop Links
8 88306600 88306770 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88308641 88308844 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88309692 88309859 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88310534 88310683 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88310999 88311147 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88312200 88312311 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88314089 88314216 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88315457 88315615 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88315748 88315880 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88317855 88318046 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88318304 88318338 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88318799 88318879 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88319074 88319146 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88320146 88320243 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88321784 88321868 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88322097 88322222 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88322935 88323033 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88323632 88323807 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88324434 88324599 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88324759 88324914 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88325367 88325513 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88326096 88326200 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88326391 88326505 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88327373 88327497 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 88327672 88327818 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3300 nt):
ATGCCAGCCAAGGGGCGCTACTTCCTAAATGAGGGTGATGAAGGCCCCGACCAGGCAGCGCTCTATGAGA
AG
TACCGGCTCACCAGCTTGCACGGGCCACTGCTGCTCTTGCTCCTCCTGGTGGCCGCGGCCACCTGCAT
T
GCGCTCATCAGCATCGCCTTCAGTCATGAGGATCTCCGCAGACACCAGGTTGTCCTGGGCACTGCGTTC
CTC
ATGCTGACGCTGTTTGTGGCTCTCTATGTGCTGGTGTATGTCGAGTGCCTGGTGCAGCGGTGGCTGC
GG
GCCTTGGCGCTACTCACCTGGGCTTGCCTCATGGTACTAGGCTCCGTGCTGATGTGGGACTCTTTGGA
G
AATGAAGCCCATGCGTGGGAGCAGGTGCCTTTCTTCCTGTTTGTCGTCTTTGTGGTGTATGCACTACTG
CCT
CTCAGCAGGAGGGCAGCCATCGTGGCAGGCGTGACCTCCACGGTCTCCCATCTCCTGGTGTTTGGAG
CT
GTGACAAGAGCCTTCCAGACGTCCATGTCTAGCACTCAACTGGGGCTGCAGCTCCTGGCCAATGCCGT
T
ATCCTCCTGGGTGGGAACTTCACGGGTGCCTTCCACAAGCACCAGCTGCAGGACGCGTCCAGGGATCTC
TTT
ATCTACACCGTCAAATGCATCCAGATCCGTCGGAAGCTTCGTGTGGAGAAGCGCCAGCAGGAGAACC
TG
CTTCTGTCAGTGCTCCCAGCACACATCTCCATGGGTATGAAGCTGGCCATCATTGAGCGCCTCAAAGA
G
GGTGGTGACCGACACTACATGCCCGACAACAACTTTCACAGCCTCTATGTCAAGCGGCACCAGAATGTC
AG
C
ATCTTGTATGCAGACATCGTGGGCTTCACGAGGCTGGCCAGCGACTGCTCTCCCAAGGAGCTGGTGG
TG
GTGCTCAACGAGCTGTTTGGGAAGTTTGACCAGATTGCTAAGGCCAATGAGTGCATGCGGATCAAGAT
C
CTGGGTGACTGTTACTACTGCGTGTCAGGCCTGCCCGTGTCGCTGCCCACACATGCCCGCAACTGTGTG
AAG
ATGGGTCTGGACATCTGCGAGGCCATTAAGCAGGTGCGTGAGGCCACGGGCGTGGACATCAGCATGC
GT
GTGGGCATTCACTCCGGGAATGTGCTATGTGGGGTCATCGGGCTCCGTAAGTGGCAGTATGATGTGTG
G
TCCCATGATGTGTCCCTGGCCAACAGGATGGAGGCAGCTGGAGTCCCTGGCCGGGTGCACATCACAGAG
GCA
ACATTGAATCACCTGGACAAGGCATATGAGGTGGAGGATGGGCATGGGGAGCAGCGAGACCCCTATC
TG
AAAGAGATGAACATCCGAACCTACCTGGTGATCGATCCCCGGAGCCAGCAGCCACCCCCACCCAGCCA
C
CACCTCTCCAAGCCCAAGGGGGACGCAACTCTGAAGATGCGGGCTTCAGTGCGTGTAACCCGCTATCTG
GAG
TCTTGGGGGGCAGCAAGGCCCTTTGCACACCTCAACCACCGGGAGAGTGTGAGCAGCAGTGAGACCC
CC
ATCTCCAATGGACGGAGGCAGAAGGCCATTCCTCTGCGTCGACACCGTGCCCCTGATAGGAGTGCATC
T
CCCAAGGGGCGCTTGGAAGATGACTGTGATGACGAGATGCTGTCAGCCATTGAGGGTCTCAGCTCCACC
AG
G
CCCTGCTGCTCCAAGTCTGATGACTTCCACACCTTTGGTCCCATCTTCTTGGAGAAGGGCTTTGAGC
GT
GAGTACCGCCTGGTGCCCATCCCCCGGGCTCGCTACGACTTCGCCTGTGCCAGCCTTGTCTTCGTCTG
C
ATCCTGCTTGTCCACCTTCTAGTGATGCCCAGGATGGCAACTCTGGGTGTGTCCTTTGGGTTGGTGGCC
TGC
CTGCTGGGGCTGGTTCTGAGTTTCTGCTTTGCTACTGAGTTCTCGAGGTGCTTTCCATCCCGAAGTA
CA
CTCCAGGCCATCTCGGAGAGCGTGGAGACGCAGCCCCTGGTCAGGCTTGTCCTGGTTGTGCTGACTGT
T
GGCAGCCTACTGACTGTCGCCATCATTAACATGCCACTGACGCTTAACCCAGGCCCAGAGCAGCCTGGA
GAC
AACAAGACAAGCCCACTGGCTGCACAGAACAGAGTTGGGACCCCATGTGAGCTCCTCCCGTACTACA
CC
TGCAGCTGCATCCTGGGCTTCATTGCATGCTCTGTTTTCCTGCGGATGAGCCTAGAGCTGAAGGCCAT
G
CTGCTGACAGTGGCCTTGGTGGCCTACCTGCTGCTCTTCAACCTCTCCCCATGCTGGCACGTCTCAGGC
AAC
AGCACTGAGACCAACGGGACACAAAGGACACGGCTGCTCCTGTCTGATGCACAAAGCATGCCCAGCC
AC
ACCCTTGCTCCGGGGGCTCGGGAGACTGCCCCTTCTCCCAGTTATTTAGAGAGAGACCTGAAGATCAT
G
GTTAACTTCTACCTGATCCTGTTCTATGCCACCCTCATCTTGCTGTCTAGACAGATTGACTACTACTGC
CGC
TTGGACTGTCTGTGGAAGAAGAAGTTCAAAAAGGAGCACGAGGAGTTTGAAACAATGGAGAATGTGA
AC
CGCCTCCTCCTGGAGAATGTGCTGCCGGCGCACGTGGCTGCCCACTTCATTGGGGACAAGGCAGCAGA
G
GATTGGTACCATCAATCTTATGACTGTGTCTGTGTCATGTTTGCATCCGTTCCGGACTTCAAAGTGTTC
TAC
ACTGAGTGTGATGTCAACAAAGAAGGACTGGAGTGCCTTCGACTGCTGAATGAGATAATTGCTGATT
TT
GACGAGCTCCTGCTGAAGCCCAAGTTTAGTGGTGTGGAGAAGATCAAGACCATTGGCAGCACCTACAT
G
GCGGCAGCAGGGCTCAGTGCCCCCTCAGGACATGAGAACCAGGACCTGGAGCGGAAGCACGTGCACATC
GGA
GTCTTGGTAGAATTTAGCATGGCCCTGATGAGCAAGCTGGATGGGATCAACAGGCACTCCTTCAACT
CC
TTCCGCCTCCGAGTCGGCATAAACCACGGGCCTGTGATTGCTGGAGTGATTGGAGCACGCAAGCCTCA
G
TATGACATCTGGGGAAACACAGTCAATGTTGCCAGCCGCATGGAGAGCACCGGAGAGCTTGGGAAAATC
CAG
GTTACCGAAGAGACATGCACTATCCTCCAGGGACTCGGATATTCGTGTGAATGCCGTGGGCTGATCA
AC
GTCAAAGGCAAAGGGGAACTGCGGACTTACTTTGTATGTACAGACACTGCCAAGTTTCAAGGGCTGGG
G
CTAAACTGA


Translation (1099 aa):
MPAKGRYFLNEGDEGPDQAALYEKYRLTSLHGPLLLLLLLVAAATCIALISIAFSHEDLRRHQVVLGTAF
L
MLTLFVALYVLVYVECLVQRWLRALALLTWACLMVLGSVLMWDSLENEAHAWEQ
VPFFLFVVFVVYALL
P
LSRRAAIVAGVTSTVSHLLVFGAVTRAFQTSMSSTQLGLQ
LLANAVILLGGNFTGAFHKHQLQDASRDL
F
IYTVKCIQIRRKLRVEKRQQ
ENLLLSVLPAHISMGMKLAIIERLKEGGDRHYMPDNNFHSLYVKRHQNV
S
ILYADIVGFTRLASDCSPKELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCV
K
MGLDICEAI
KQVREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITE
A
TLNHLDKAYEVEDGHGEQRDPYLKEMNIRTYLVIDPR
SQQPPPPSHHLSKPKGDATLKMRASVRVTRYL
E
SWGAARPFAHLNHRESVSSSETPISNGRRQK
AIPLRRHRAPDRSASPKGRLEDDCDDEMLSAIEGLSST
R
PCCSKSDDFHTFGPIFLEKGFEREYRLVPIPRARYDFACASLVFVCILLVHLLVMPRMATLGVSFGLVA
C
LLGLVLSFCFATEFS
RCFPSRSTLQAISESVETQPLVRLVLVVLTVGSLLTVAIINMPLTLNPGPEQPG
D
NKTSPLAAQNRVGTPCELLP
YYTCSCILGFIACSVFLRMSLELKAMLLTVALVAYLLLFNLSPCWHVSG
N
STETNGTQ
RTRLLLSDAQSMPSHTLAPGARETAPSPSYLERDLKIMVNFYLILFYATLILLSRQIDYYC
R
LDCLWKKKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKAAE
DWYHQSYDCVCVMFASVPDFKVF
Y
TECDVNKEGLECLRLLNEIIADFDE
LLLKPKFSGVEKIKTIGSTYMAAAGLSAPSGHENQDLERKHVHI
G
VLVEFSMALMSKLDGINRHSFNSFRLRV
GINHGPVIAGVIGARKPQYDIWGNTVNVASRMESTGELGKI
Q
VTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGLN



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser