NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS57413.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57413.1 Public Mus musculus 6 Cadps2 16 104 75 CCDS HistoryNCBI Gene:320405Re-query CCDS DB by CCDS ID:57413.1Re-query CCDS DB by GeneID:320405See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Sequence IDs included in CCDS 57413.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000115356 ENSMUSP00000111013 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115356Link to Ensembl Protein Viewer:ENSMUSP00000111013Re-query CCDS DB by Nucleotide ID:ENSMUST00000115356Re-query CCDS DB by Protein ID:ENSMUSP00000111013
Original member Current member EBI,WTSI OTTMUST00000054999 OTTMUSP00000026279 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000054999Link to Vega Protein Viewer:OTTMUSP00000026279Re-query CCDS DB by Nucleotide ID:OTTMUST00000054999Re-query CCDS DB by Protein ID:OTTMUSP00000026279
Original member Current member NCBI NM_001252107.1 NP_001239036.1 Accepted alive Link to Nucleotide Sequence:NM_001252107.1Link to Protein Sequence:NP_001239036.1Re-query CCDS DB by Nucleotide ID:NM_001252107Re-query CCDS DB by Protein ID:NP_001239036Link to BLink:NP_001239036.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001239036.1 768 Q8BYR5-6 768 100% 0 0

Chromosomal Locations for CCDS 57413.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 23409925 23410042 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 23410742 23410929 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 23412948 23413084 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 23427164 23427364 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 23429110 23429218 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 23443972 23444038 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 23496758 23496897 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 23528052 23528163 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 23583342 23583463 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 23587377 23587613 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 23599430 23599510 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 23626493 23626825 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 23688847 23688960 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 23838790 23839137 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2307 nt):
ATGCTCGACCCGTCTTCCAGCGAGGAGGAGTCGGACGAGGGGCTGGAGGAGGAGAGCCGCGAGGTGTTGG
TG
GCGCCGGGCGTCTCCCAGCGAGCGCCGCCGGCCGCGGCTCGGGAAGGGCGGCGGGACGCGCCGGGACG
C
TCCGGTGGTGGCAGCGGCGGCGGAGCGGCCAGACCCGTGAGCCCGAGCCCCTCGGTACTCAGCGAGGGG
CGA
AATGAGCCCGAGCTGCAGCTGGACGAGGAGCAGGAGCGGCGCATCCGCCTGCAGCTCTACGTCTTCG
TG
GTGAGGTGCATCGCGTACCCATTCAACGCCAAGCAGCCCACCGACATGGCCCGGAGGCAGCAGAAGCT
T
AACAAACAACAATTGCAGTTACTGAAAGAACGGTTCCAGGCCTTTCTCAATGGAGAAACTCAGATAGTA
GCA
GACGAAGCCTTCTGCAATGCCGTCCGGAGTTACTATGAGGTGTTTCTAAAGAGTGACCGTGTGGCCA
GA
ATGGTTCAAAGTGGAGGATGCTCTGCTAATGATTTCAGAGAGGTGTTTAAGAAGAACATAGAAAAACG
T
GTCCGTAGCCTGCCAGAGATAGATGGCCTGAGCAAAGAGACAGTGCTGAGCTCATGGATAGCCAAATAT
GAC
GCCATTTACAGGGGAGAAGAAGATTTGTGCAAACAGCCGAACAGGATGACCCTCAGTGCCGTGTCTG
AG
CTTATTCTGAGTAAGGAGCAGCTCTATGAAATGTTCCAGCAGATTCTGGGCATTAAGAAGCTGGAACA
C
CAGCTACTTTATAACGCATGCCAGCTGGATAACGCTGATGAACAAGCAGCCCAGATCAGAAGGGAACTT
GAT
GGCCGCCTGCAGTTGGCAGAGAAGATGGCAAAGGAGAGAAGATTCCCCAGATTCATCTCGAAAGAAA
TG
GAGAGTATGTACATTGAAGAGCTGCGAGCCTCCGTGAACCTGCTAATGGCCAATTTAGAAAGTCTTCC
A
GTTTCAAAAGGTGGCCCGGAATTTAAATTACAAAAATTAAAGCGTTCGCAGAACTCTGCGTTTCTGGAC
CTG
GGAGATGAGAACGAGATCCAGCTGTCCAAGTCGGATGTGGTGTTGTCGTTCACGTTAGAGATTGTCA
TC
ATGGAAGTGCAAGGACTGAAATCTGTGGCTCCCAATCGAATCGTTTACTGCACAATGGAGGTGGAAGG
A
GGAGAAAAACTCCAGACAGACCAGGCTGAAGCATCAAGGCCACAATGGGGGACCCAAGGAGATTTCAAC
ACT
ACCCACCCTCGGCCTGTCGTCAAAGTGAAGCTCTTCACAGAAAGCACGGGGGTCCTGGCCCTGGAAG
AC
AAGGAACTGGGCAGGGTGGTGTTATACCCAACTTCTAATAGCTCCAAGTCAGCAGAGTTACACCGAAT
G
ACAGTACCCAAGAACAGTCAGGACTCGGACCTAAAGATCAAATTGGCAGTGCGCATGGATAAACCAGCA
CAC
ATGAAGCATAGTGGGTACCTGTATGCCCTTGGACAGAAGGTTTGGAAAAGATGGAAAAAGCGTTACT
TT
GTTCTCGTTCAGGTTAGCCAGTACACCTTTGCTATGTGCAGCTATAGAGAAAAAAAGTCGGAACCACA
G
GAATTAATGCAACTGGAAGGATACACAGTGGATTACACAGACCCTCACCCAGGCCTTCAGGGTGGTCAG
GTG
TTCTTCAACGCTGTTAAAGAGGGAGATACTGTGATCTTTGCCAGTGATGATGAACAGGACAGAATAT
TA
TGGGTACAAGCCATGTACAGGGCTACAGGCCAGTCTTACAAACCAGTTCCTGCAGTCCAAAGCCAGAA
G
CTGAATCCTAAAGGCGGAGCTCTCCATGCAGATGCTCAGCTTTATGCAGACCGTTTTCAGAAACACGGG
ATG
GATGAGTTTATTTCTGCGAGTCCTTGCAAGCTTGACCATGCCTTCCTCTTCAGAATTCTCCAGAGAC
AG
ACTTTGGATCACAGACTGAATGATTCGTATTCTTGTTTGGGGTGGTTTAGCCCTGGCCAAGTCTTTGT
G
TTAGATGAGTACTGTGCCCGCTACGGAGTGAGAGGCTGTCACAGGCATCTCTGCTACCTTACAGAACTG
ATG
GAACATTCAGAAAACGGTGCTGTCATTGACCCCACCCTGCTCCATTACAGCTTTGCATTCTGTGCCT
CT
CACGTGCACGGCAACAGATTTCTTTCTTTCTTTTTTTTTTTTTTCTTCCCACAATCCTGTGTGAGTTT
C
AGGTTATTTACAGAGTGGCAGAGTGTTGAAGGAACTCAGCGTTCAGAACATCCTGACTCAAATTGA


Translation (768 aa):
MLDPSSSEEESDEGLEEESREVLVAPGVSQRAPPAAAREGRRDAPGRSGGGSGGGAARPVSPSPSVLSEG
R
NEPELQLDEEQERRIRLQLYVFVVRCIAYPFNAKQPTDMARRQQK
LNKQQLQLLKERFQAFLNGETQIV
A
DEAFCNAVRSYYE
VFLKSDRVARMVQSGGCSANDFREVFKKNIEKRVRSLPEIDGLSKETVLSSWIAKY
D
AIYRGEEDLCKQPNRMTLSAVSELILSKEQLYEMFQQILGIKKLEHQLLYNACQ
LDNADEQAAQIRREL
D
GRLQLAEKMAK
ERRFPRFISKEMESMYIEELRASVNLLMANLESLPVSKGGPEFKLQKLKRSQNSAFLD
L
GDENEIQLSKSDVVLSFTLE
IVIMEVQGLKSVAPNRIVYCTMEVEGGEKLQTDQAEASRPQWGTQGDFN
T
THPRPVVKVKLFTESTGVLALEDKELGR
VVLYPTSNSSKSAELHRMTVPKNSQDSDLKIKLAVRMDKPA
H
MKHS
GYLYALGQKVWKRWKKRYFVLVQVSQYTFAMCSYREKKSEPQELMQLEGYTVDYTDPHPGLQGGQ
V
FFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSYKPVPAVQSQKLNPKGGALHADAQL
YADRFQKHG
M
DEFISASPCKLDHAFLFRILQRQTLDHRLNDSYSCL
GWFSPGQVFVLDEYCARYGVRGCHRHLCYLTEL
M
EHSENGAVIDPTLLHYSFAFCASHVHGN
RFLSFFFFFFFPQSCVSFRLFTEWQSVEGTQRSEHPDSN



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser