NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30296.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30296.1 Public Mus musculus X Yipf6 16 104 75 CCDS HistoryNCBI Gene:77929Re-query CCDS DB by CCDS ID:30296.1Re-query CCDS DB by GeneID:77929See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 30296.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000054697 ENSMUSP00000056039 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000054697Link to Ensembl Protein Viewer:ENSMUSP00000056039Re-query CCDS DB by Nucleotide ID:ENSMUST00000054697Re-query CCDS DB by Protein ID:ENSMUSP00000056039
Original member Current member EBI,WTSI ENSMUST00000113811 ENSMUSP00000109442 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113811Link to Ensembl Protein Viewer:ENSMUSP00000109442Re-query CCDS DB by Nucleotide ID:ENSMUST00000113811Re-query CCDS DB by Protein ID:ENSMUSP00000109442
Original member Current member EBI,WTSI OTTMUST00000043586 OTTMUSP00000019586 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000043586Link to Vega Protein Viewer:OTTMUSP00000019586Re-query CCDS DB by Nucleotide ID:OTTMUST00000043586Re-query CCDS DB by Protein ID:OTTMUSP00000019586
Original member Current member EBI,WTSI OTTMUST00000043587 OTTMUSP00000019587 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000043587Link to Vega Protein Viewer:OTTMUSP00000019587Re-query CCDS DB by Nucleotide ID:OTTMUST00000043587Re-query CCDS DB by Protein ID:OTTMUSP00000019587
Original member Current member NCBI NM_207633.2 NP_997516.1 Accepted alive Link to Nucleotide Sequence:NM_207633.2Link to Protein Sequence:NP_997516.1Re-query CCDS DB by Nucleotide ID:NM_207633Re-query CCDS DB by Protein ID:NP_997516Link to BLink:NP_997516.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_997516.1 236 Q8BR70 236 100% 0 0

Chromosomal Locations for CCDS 30296.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 98938232 98938288 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 98939773 98939901 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 98940122 98940200 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 98940787 98940829 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 98942778 98942906 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 98943478 98943635 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 98944873 98944988 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (711 nt):
ATGGCGGAAGCGGAGGACTCTCCGGGAGAACAGGAGGCAGCGGCATCCAAGCCCCTGTTTGCAGGGTTGT
CT
GATGTGTCAATTTCTCAGGACATTCCCATAGAAGGGGAGATTACCATCCCCTCCAGAGCTCGTGCTCA
A
GAACATGACAGCTCCACACTGAATGAATCCATTCGTCGGACCATTATGCGAGATCTAAAAGCTGTGGGA
AGG
AAATTTATGCATGTTTTATATCCAAGGAAGAGTAATGCACTGTTAAGAGACTGGGACCTGTGGGGCC
CA
TTGATACTTTGTGTGACACTTGCATTGATGTTACAGAAAAGTTCCATTGATGGGAAGAATGATGGCGG
A
GGCCCAGAATTCGCAGAAGTATTTGTTATCATCTGGTTTGGAGCAGTTACCATCACGCTGAATTCCAAA
CTT
CTTGGCGGAAACATTTCTTTTTTTCAGAGTCTCTGTGTATTAGGGTACTGCATTCTTCCTTTGAACA
TC
GCAATGCTGATCTGCCGCTTGCTGCTTTTGGCTGGACAGGGACCAATAAACTTCATGATTCGGCTTTT
T
GTAGTGTTGTTGATGTTCGCTTGGTCCGTGGTGGCATCTACAGCATTCCTTGCTGACAGCCAGCCTCCA
AAC
AGAAAAGCCCTGGCAGTGTATCCTGTCTTTTTATTCTACTTTGTCATCAGTTGGATGATACTCACGT
TC
ACGCCATGA


Translation (236 aa):
MAEAEDSPGEQEAAASKPLFAGLSDVSISQDIPIEGEITIPSRARAQEHDSSTLNESIRRTIMRDLKAVG
R
KFMHVLYPRKSNALLRD
WDLWGPLILCVTLALMLQKSSIDGKNDGGGPEFAEVFVIIWFGAVTITLNSK
L
LGGN
ISFFQSLCVLGYCILPLNIAMLICRLLLLAGQGPINFMIRLFVVLLMFAWSVVASTAFLADSQPP
N
RKALAVYPVFLFYFVISWMILTFTP




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser