NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS20556.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20556.1 Public Mus musculus 6 Kcna6 16 104 75 CCDS HistoryNCBI Gene:16494Re-query CCDS DB by CCDS ID:20556.1Re-query CCDS DB by GeneID:16494

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39


Attributes
Nonsense-mediated decay (NMD) candidate

Sequence IDs included in CCDS 20556.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000040751 ENSMUSP00000036872 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000040751Link to Ensembl Protein Viewer:ENSMUSP00000036872Re-query CCDS DB by Nucleotide ID:ENSMUST00000040751Re-query CCDS DB by Protein ID:ENSMUSP00000036872
Original member Current member EBI,WTSI ENSMUST00000112242 ENSMUSP00000107861 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112242Link to Ensembl Protein Viewer:ENSMUSP00000107861Re-query CCDS DB by Nucleotide ID:ENSMUST00000112242Re-query CCDS DB by Protein ID:ENSMUSP00000107861
Original member Current member EBI,WTSI OTTMUST00000053659 OTTMUSP00000025521 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000053659Link to Vega Protein Viewer:OTTMUSP00000025521Re-query CCDS DB by Nucleotide ID:OTTMUST00000053659Re-query CCDS DB by Protein ID:OTTMUSP00000025521
Original member Current member EBI,WTSI OTTMUST00000061033 OTTMUSP00000029861 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000061033Link to Vega Protein Viewer:OTTMUSP00000029861Re-query CCDS DB by Nucleotide ID:OTTMUST00000061033Re-query CCDS DB by Protein ID:OTTMUSP00000029861
Original member Current member NCBI NM_013568.6 NP_038596.1 Accepted alive Link to Nucleotide Sequence:NM_013568.6Link to Protein Sequence:NP_038596.1Re-query CCDS DB by Nucleotide ID:NM_013568Re-query CCDS DB by Protein ID:NP_038596Link to BLink:NP_038596.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038596.1 529 Q61923 529 100% 0 0

Chromosomal Locations for CCDS 20556.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

Chromosome Start Stop Links
6 126738335 126739924 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1590 nt):
ATGAGATCGGAGAAATCCCTGACGCTGGCGGCGCCGGGGGAGGTCCGTGGGCCGGAGGGGGAGCAACAGG
AT
GCGGGTGAGTTCCAGGAGGCCGAGGGCGGCGGCGGCTGCTGTAGTAGTGAGAGGTTGGTGATCAACAT
C
TCCGGGCTGCGCTTCGAGACGCAGCTGCGCACCCTGTCGCTGTTCCCTGACACGCTGCTAGGAGACCCT
GGC
CGCAGAGTCCGTTTCTTTGACCCCTTGAGGAACGAGTACTTCTTTGACCGCAACCGACCCAGCTTCG
AC
GCTATCCTTTATTACTATCAATCTGGAGGTCGCCTGCGCAGGCCTGTTAATGTGCCCCTGGACATTTT
T
ATGGAAGAGATCCGCTTCTATCAGTTGGGAGAGGAAGCCCTGGCGGCCTTCCGGGAGGATGAGGGTTGC
CTG
CCCGAAGGTGGCGAGGATGAGAAACCACTCCCCTCCCAGCCTTTCCAGCGACAGGTCTGGCTTCTCT
TT
GAGTACCCGGAGAGTTCCGGGCCCGCCCGAGGCATCGCCATCGTCTCAGTATTGGTCATCCTCATCTC
C
ATCGTCATCTTTTGCCTGGAGACCTTGCCTCAATTCCGTGCAGATGGGCGCGGTGGAAGCAACGAGGGT
AGT
GGGACCCGCTTGTCTCCGGCCTCCAGGAGCCACGAGGAAGAAGATGAGGATGAAGATTCCTATGCAT
TT
CCTGGTAGCATTCCCTCTGGGGGGTTGGGGACTGGAGGAACATCTTCACTTAGTACTCTCGGGGGTTC
T
TTCTTCACAGACCCCTTCTTCTTGGTGGAAACTCTGTGTATCGTCTGGTTCACGTTTGAGCTCCTGGTG
CGC
TTCTCTGCCTGTCCCAGCAAGGCGGCCTTCTTTCGCAATATCATGAACATCATTGACTTGGTGGCCA
TT
TTCCCCTACTTTATCACCTTGGGCACCGAGCTAGTGCAACGTCACGAGCAGCAGTCTGTGAGTGGTGG
C
AGTGGTCAGAATGGGCAGCAGGCCATGTCCCTAGCCATCCTCAGGGTGATCCGCCTGGTCCGGGTGTTC
CGA
ATCTTCAAGCTCTCCCGCCATTCCAAGGGGCTGCAGATCCTGGGTAAGACCTTACAGGCGTCCATGC
GG
GAGCTCGGGCTGCTCATCTTCTTCCTCTTCATCGGAGTCATCCTCTTTTCCAGCGCTGTCTACTTCGC
A
GAGGCTGATGATGTTGACTCGCTCTTCCCTAGCATCCCAGATGCCTTCTGGTGGGCTGTGGTTACAATG
ACC
ACGGTAGGTTATGGGGACATGTACCCCATGACGGTAGGGGGCAAGATTGTGGGCTCACTGTGCGCCA
TT
GCTGGGGTCCTCACCATTGCATTACCGGTACCGGTCATTGTCTCCAATTTCAACTACTTCTACCACCG
A
GAGACGGAGCAGGAGGAGCAAGGCCAGTATACCCACGTCACTTGTGGGCAGCCCACTCCGGACTTGAAG
GCA
ACGGACAATGGGCTTGGCAAACCTGACTTTGCCGAGGCTTCACGGGAACGCCGGCCCAGCTACCTTC
CG
ACTCCACATCGAGCTTATGCGGAGAAAAGGATGCTCACCGAGGTTTGA


Translation (529 aa):
MRSEKSLTLAAPGEVRGPEGEQQDAGEFQEAEGGGGCCSSERLVINISGLRFETQLRTLSLFPDTLLGDP
G
RRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFMEEIRFYQLGEEALAAFREDEGC
L
PEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPQFRADGRGGSNEG
S
GTRLSPASRSHEEEDEDEDSYAFPGSIPSGGLGTGGTSSLSTLGGSFFTDPFFLVETLCIVWFTFELLV
R
FSACPSKAAFFRNIMNIIDLVAIFPYFITLGTELVQRHEQQSVSGGSGQNGQQAMSLAILRVIRLVRVF
R
IFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDVDSLFPSIPDAFWWAVVTM
T
TVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHVTCGQPTPDLK
A
TDNGLGKPDFAEASRERRPSYLPTPHRAYAEKRMLTEV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser