NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25420.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25420.1 Public Mus musculus 11 Jup 19 105 81 CCDS HistoryNCBI Gene:16480Re-query CCDS DB by CCDS ID:25420.1Re-query CCDS DB by GeneID:16480See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 25420.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000001592 ENSMUSP00000001592 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000001592Link to Ensembl Protein Viewer:ENSMUSP00000001592Re-query CCDS DB by Nucleotide ID:ENSMUST00000001592Re-query CCDS DB by Protein ID:ENSMUSP00000001592
Original member Current member EBI,WTSI ENSMUST00000107403 ENSMUSP00000103026 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107403Link to Ensembl Protein Viewer:ENSMUSP00000103026Re-query CCDS DB by Nucleotide ID:ENSMUST00000107403Re-query CCDS DB by Protein ID:ENSMUSP00000103026
Original member Current member EBI,WTSI OTTMUST00000014199 OTTMUSP00000006595 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000014199Link to Vega Protein Viewer:OTTMUSP00000006595Re-query CCDS DB by Nucleotide ID:OTTMUST00000014199Re-query CCDS DB by Protein ID:OTTMUSP00000006595
Original member Current member EBI,WTSI OTTMUST00000014200 OTTMUSP00000006596 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000014200Link to Vega Protein Viewer:OTTMUSP00000006596Re-query CCDS DB by Nucleotide ID:OTTMUST00000014200Re-query CCDS DB by Protein ID:OTTMUSP00000006596
Original member Current member NCBI NM_010593.2 NP_034723.1 Accepted alive Link to Nucleotide Sequence:NM_010593.2Link to Protein Sequence:NP_034723.1Re-query CCDS DB by Nucleotide ID:NM_010593Re-query CCDS DB by Protein ID:NP_034723Link to BLink:NP_034723.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034723.1 745 Q02257 745 100% 0 0

Chromosomal Locations for CCDS 25420.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 100372310 100372461 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100372656 100372695 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100374078 100374199 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100374326 100374476 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100376723 100376998 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100378089 100378427 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100379522 100379625 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100380544 100380688 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100381676 100381877 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100383007 100383245 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100383395 100383654 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100386173 100386380 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2238 nt):
ATGGAGGTGATGAACCTTATTGAGCAGCCCATCAAGGTGACAGAGTGGCAACAGACATACACCTACGACT
CG
GGCATCCACTCCGGCGTCAATACCTGTGTGCCCTCTGTAAGCAGCAAGGGCATCATGGATGAGGATGA
T
GCCTGCGGCAGACAGTACACACTCAAGAAGACTACCACCTATACACAAGGGGTGCCACAGAACCAAGGT
GAC
CTGGAATACCAGATGTCCACAACGGCCAGAGCCAAGCGGGTGCGGGAGGCCATGTGTCCAGGGGTCT
CA
GGCGAGGACAGTTCTCTACTGCTGGCCACCCAGGTGGAGGGGCAGACAACCAATCTGCAGCGCCTGGC
C
GAACCATCCCAGTTGCTCAAGTCGGCCATCGTCCATCTCATCAACTACCAGGATGATGCAGAGCTGGCC
ACC
CGGGCTCTGCCTGAGCTCACCAAGCTGCTCAACGATGAGGACCCGGTAGTGGTGACCAAGGCGGCTA
TG
ATCGTGAACCAGCTGTCCAAGAAGGAGGCATCCCGCCGGGCTCTAATGGGCTCGCCCCAGCTGGTGGC
G
GCGGTGGTGCGGACTATGCAGAACACCAGTGACCTGGATACTGCCCGGTGTACCACCAGCATCCTGCAC
AAC
CTCTCTCACCACCGAGAGGGCTTGCTCGCCATATTCAAGTCTGGAGGCATCCCTGCCCTAGTCCGAA
TG
CTCAGTTCCCCCGTAGAATCTGTCCTGTTCTACGCCATCACCACACTGCACAACCTGCTGCTCTATCA
G
GAGGGCGCCAAGATGGCGGTGCGTCTGGCAGACGGGCTGCAGAAGATGGTGCCCCTACTCAACAAGAAC
AAC
CCTAAGTTCCTGGCCATCACTACTGACTGCCTGCAGCTCCTGGCCTATGGCAACCAGGAGAGCAAGC
TG
ATCATCCTGGCCAATGGGGGACCCCAAGGGCTTGTGCAGATCATGAGGAACTACAGCTACGAGAAGCT
T
CTGTGGACCACCAGCCGTGTGCTCAAGGTGCTCTCCGTGTGTCCTAGCAACAAGCCCGCCATCGTGGAG
GCT
GGTGGGATGCAGGCTCTGGGCAAGCACTTGACAAGCAACAGTCCCCGCCTGGTGCAGAACTGCCTGT
GG
ACTCTGCGCAATCTCTCGGATGTAGCCACCAAGCAGGAGGGCCTGGAGAGTGTGCTGAAGATCCTGGT
C
AACCAACTGAGTGTAGATGACGTCAACGTCCTCACCTGTGCCACGGGCACCCTCTCCAACCTGACCTGC
AAC
AACAGCAAAAACAAGACGCTGGTGACACAGAACAGTGGCGTGGAGGCGCTCATCCACGCCATCCTGA
GA
GCCGGAGACAAAGATGACATCACAGAGCCCGCTGTCTGTGCCCTGCGCCACCTTACCAGCCGTCACCC
C
GAGGCTGAGATGGCCCAGAACTCTGTGCGCCTCAACTATGGAATCCCGGCCATTGTGAAACTGCTCAAC
CAG
CCAAACCAGTGGCCACTGGTCAAGGCAACTATTGGCCTGATCCGGAACCTGGCTCTGTGCCCAGCCA
AC
CATGCCCCTCTGCAGGAGGCCGCGGTCATTCCCCGCCTCGTCCAGCTGTTGGTCAAGGCCCACCAGGA
C
GCCCAGCGCCATGTGGCTGCAGGCACCCAGCAGCCCTACACGGATGGTGTGAGGATGGAGGAGATCGTG
GAA
GGCTGCACCGGAGCCCTGCACATCCTCGCCCGGGATCCCATGAACCGCATGGAGATCTTCCGGCTCA
AC
ACCATTCCCCTGTTTGTCCAGCTCCTGTACTCCTCTGTGGAGAACATCCAGCGTGTGGCTGCGGGAGT
G
CTCTGCGAGCTGGCCCAGGACAAGGAGGCTGCCGACGCCATTGATGCGGAGGGCGCCTCTGCCCCTCTC
ATG
GAGCTACTCCATTCCCGCAATGAGGGCACCGCGACCTACGCTGCTGCTGTCCTGTTCCGCATCTCTG
AG
GACAAGAACCCAGATTACCGTAAGCGAGTGTCTGTGGAGCTCACCAATTCCCTCTTCAAGCATGACCC
A
GCTGCCTGGGAGGCTGCCCAGAGTATGATCCCGATCAACGAACCCTATGCAGACGACATGGATGCCACC
TAC
CGCCCCATGTACTCCAGCGATGTGCCTCTGGACCCTCTGGACATGCACATGGACCTGGATGGAGACT
AC
CCCATGGACACCTACAGTGACGGCCTGAGGCCTCCCTACCCCACTGCAGACCACATGCTGGCCTAG


Translation (745 aa):
MEVMNLIEQPIKVTEWQQTYTYDSGIHSGVNTCVPSVSSKGIMDEDDACGRQYTLKKTTTYTQGVPQNQG
D
LEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQTTNLQRLAEPSQLLKSAIVHLINYQDDAELA
T
RALPELTKLLNDEDP
VVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILH
N
LSHHREGLLAIFKSGGIPALVRML
SSPVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKN
N
PKFLAITTDCLQLLAYGNQESK
LIILANGGPQGLVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVE
A
GGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTC
N
NSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLN
Q
PNQWPLVK
ATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIV
E
GCTGALHILARDPMNRMEIFRLNTIPLFVQ
LLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPL
M
ELLHSRNEGT
ATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYADDMDAT
Y
RPMYSSDVPLDPLDMHMDLDGDYPMDTYSDGLRPPYPTADHMLA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser