NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28474.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28474.1 Public Mus musculus 17 Pdpk1 16 104 75 CCDS HistoryNCBI Gene:18607Re-query CCDS DB by CCDS ID:28474.1Re-query CCDS DB by GeneID:18607

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 28474.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000102927 ENSMUSP00000099991 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000102927Link to Ensembl Protein Viewer:ENSMUSP00000099991Re-query CCDS DB by Nucleotide ID:ENSMUST00000102927Re-query CCDS DB by Protein ID:ENSMUSP00000099991
Original member Current member EBI,WTSI OTTMUST00000039074 OTTMUSP00000017452 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000039074Link to Vega Protein Viewer:OTTMUSP00000017452Re-query CCDS DB by Nucleotide ID:OTTMUST00000039074Re-query CCDS DB by Protein ID:OTTMUSP00000017452
Original member Current member NCBI NM_011062.4 NP_035192.2 Accepted alive Link to Nucleotide Sequence:NM_011062.4Link to Protein Sequence:NP_035192.2Re-query CCDS DB by Nucleotide ID:NM_011062Re-query CCDS DB by Protein ID:NP_035192Link to BLink:NP_035192.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035192.2 559 Q9Z2A0 559 100% 0 0

Chromosomal Locations for CCDS 28474.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

Chromosome Start Stop Links
17 24079026 24079142 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 24079492 24079644 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 24080378 24080435 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 24088004 24088221 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 24091421 24091594 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 24093191 24093287 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 24093540 24093608 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 24098094 24098169 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 24100811 24100908 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 24101602 24101746 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 24106827 24106964 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 24107229 24107271 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 24110848 24111117 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 24141437 24141460 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1680 nt):
ATGGCCAGGACCACCAGCCAGCTGTATGACGCTGTGCCCATTCAGTCCAGTGTGGTGCTATGTTCCTGCC
CA
TCCCCATCAATGGTGAGGTCCCAGACTGAGCCCGGTTCGTCCCCTGGCATTCCTAGTGGTGTTAGCAG
G
CAGGGATCCACCATGGATGGCACCACAGCTGAAGCCCGACCAAGCACCAACCCCTTGCAGCAGCACCCT
GCC
CAGCTGCCACCACAGCCTCGCAAGAAACGCCCTGAAGACTTCAAGTTTGGGAAAATTCTTGGCGAGG
GC
TCTTTTTCAACAGTTGTTCTGGCCCGAGAACTGGCCACTTCCAGAGAATATGCTATTAAAATTCTGGA
G
AAACGTCATATTATAAAAGAAAACAAAGTTCCGTATGTAACTAGAGAGAGAGATGTGATGTCACGCCTG
GAT
CACCCCTTCTTTGTGAAACTTTATTTTACATTTCAGGACGACGAAAAGCTGTATTTTGGCCTTAGTT
AT
GCCAAAAATGGAGAGCTACTTAAATACATCCGCAAAATTGGCTCATTTGATGAGACCTGTACCCGGTT
T
TACACGGCTGAGATTGTGTCTGCTTTAGAGTACTTGCATGGCAAGGGCATCATTCACAGAGACCTTAAA
CCA
GAAAACATTTTGTTAAATGAAGACATGCACATCCAGATCACAGATTTTGGAACAGCAAAAGTGTTAT
CC
CCAGAGAGCAAACAAGCCAGGGCCAACTCATTTGTAGGAACAGCACAGTATGTTTCTCCAGAGCTGCT
C
ACAGAGAAGTCGGCGTGTAAAAGTTCAGACCTTTGGGCCCTTGGATGTATAATCTATCAGCTCGTGGCA
GGA
CTCCCACCATTCAGAGCCGGGAATGAATATCTTATATTTCAGAAGATCATTAAGCTGGAATATCATT
TC
CCAGAAAAATTCTTCCCTAAGGCTAGAGATCTTGTGGAAAAACTCTTGGTTTTAGATGCCACAAAGCG
T
TTAGGCTGTGAAGAGATGGAAGGGTACGGGCCTCTCAAAGCTCATCCATTCTTTGAGACCATCACTTGG
GAG
AATTTGCACCAGCAGACACCTCCGAAGCTCACAGCTTACCTACCAGCCATGTCAGAGGATGATGAAG
AC
TGCTATGGCAACTACGACAATCTCCTGAGCCAGTTTGGCTTCATGCAGGTGTCATCCTCCTCCTCTTC
C
CACTCCCTGTCTACGGTGGAAACCAGCCTGCCCCAGAGGTCGGGCAGCAACATAGAGCAGTACATCCAT
GAT
TTGGACACTAACTCTTTTGAACTAGACTTACAGTTTTCAGAAGATGAAAAAAGGTTGTTATTGGAAA
AG
CAAGCCGGTGGAAACCCTTGGCACCAGTTTGTAGAAAATAATCTAATATTAAAAATGGGTCCAGTGGA
T
AAGCGAAAGGGTTTATTTGCAAGACGACGACAGTTATTACTCACAGAAGGGCCACATTTATATTATGTT
GAT
CCTGTCAACAAGGTCTTGAAAGGTGAAATCCCATGGTCACAAGAACTCCGACCAGAAGCCAAGAATT
TT
AAAACTTTCTTTGTCCACACGCCTAACAGGACGTACTACCTGATGGATCCAAGCGGGAATGCTCACAA
G
TGGTGCAGAAAGATCCAGGAGGTTTGGAGGCAGCAGTACCAGAGCAATCCAGATGCTGCTGTGCAGTGA


Translation (559 aa):
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRSQTEPGSSPGIPSGVSRQGSTMDGTTAEARPSTNPLQQHP
A
QLPPQPRKKRPEDFKFGKILGEGSFST
VVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRL
D
HPFFVKLYFTFQDDEKL
YFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLK
P
ENILLNEDMHIQITDFGTAKVLSPESKQ
ARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVA
G
LPPFRA
GNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFETITW
E
NLHQQTPPKLTAYLPAMSEDDEDCYGN
YDNLLSQFGFMQVSSSSSSHSLSTVETSLPQRSGSNIEQYIH
D
LDTNSFELDLQFSEDEKRLLLEKQAGGNP
WHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYV
D
PVNKVLKGEIPWSQELRPEAKNFKTFFVHT
PNRTYYLMDPSGNAHKWCRKIQEVWRQQYQSNPDAAVQ



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser