NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51531.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51531.1 Public Mus musculus 5 Tmprss11a 16 104 75 CCDS HistoryNCBI Gene:194597Re-query CCDS DB by CCDS ID:51531.1Re-query CCDS DB by GeneID:194597

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 51531.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000101073 ENSMUSP00000098634 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000101073Link to Ensembl Protein Viewer:ENSMUSP00000098634Re-query CCDS DB by Nucleotide ID:ENSMUST00000101073Re-query CCDS DB by Protein ID:ENSMUSP00000098634
Original member Current member EBI,WTSI OTTMUST00000089304 OTTMUSP00000048793 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000089304Link to Vega Protein Viewer:OTTMUSP00000048793Re-query CCDS DB by Nucleotide ID:OTTMUST00000089304Re-query CCDS DB by Protein ID:OTTMUSP00000048793
Original member Current member NCBI NM_001033233.2 NP_001028405.1 Accepted alive Link to Nucleotide Sequence:NM_001033233.2Link to Protein Sequence:NP_001028405.1Re-query CCDS DB by Nucleotide ID:NM_001033233Re-query CCDS DB by Protein ID:NP_001028405Link to BLink:NP_001028405.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001028405.1 389 Q3UQ41 389 100% 0 0

Chromosomal Locations for CCDS 51531.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

Chromosome Start Stop Links
5 86411762 86411923 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 86414477 86414619 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 86420002 86420261 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 86422494 86422665 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 86428558 86428718 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 86431843 86431910 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 86444109 86444185 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 86445763 86445884 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 86468851 86468855 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1170 nt):
ATGGAAGTGGCAGGATATGGCACCCACAACAGAGATCTGAAGCAATGGATGGTTACCCTTCTCTCTGCTC
TC
TCCCTGATGATGGTGGTAGTGACCATTGGACTTCTGGCTCTCTTCCTCGTGTTCGATATTCAAGTCAA
T
AGCAACTCAGGACAAAAGAGCTCAAATCAACTGAAGGACTTACAAGAGACGAATGAAAATTTGGTAGAT
GAA
ATATTTATAGATTCAGCCTTGAACAATCGCTACATCAAAAACCACGTAGTCGGACTAACACCAGAAG
AG
GATGATACAAAAGCAGACATTGTCATGGTGTTCCAGCCTCCCGCTACAGGGCGAAGAACCGTAGGGAA
A
AAGACGCACCATAGCATCTTAGATCAGAAGACAAGGAACGCAAGAGCTTTGCCAGCTGATGTCTCACTG
GTT
CAAGTTAAAGATTGTGGCAAGCGAGCTATCCCATTAATTGCCAACAGAATAGTGTCTGGAAACCCTG
CA
GCTAAGGGTGCCTGGCCGTGGCAAGTTTCCCTTCAGCGAAGCAACATCCATCAGTGTGGGGGCACGTT
G
ATTGGTAACATGTGGGTCGTCACTGCAGCACACTGTTTTAGAACCAATTCAAACCCTCGCCAATGGACT
CTT
AGTTTTGGAACAACAATAAATCCTCCCTTAATGAAAAGAGACGTCAGAAGAATTATTATGCATGAAA
GG
TATCGTCCCCCAGCAAGAGACCATGACATTGCTCTAGTGCAGTTTTCTCCCAGAGTCACCTTTTCGGA
T
GAAGTGCGCCGAATTTGTTTGCCAGAACCCTCTGCATCTTTCCCACCAAATTCAACTGTCTACATCACA
GGA
TTCGGAGCACTTTACTATGGCGGGGAATCCCAAAATGAGCTCCGTGAAGCCAGAGTACAAATCATAA
GC
AATGACATCTGCAAGAAGCGACACGTGTATGGCAATGAAATAAAACGTGGGATGTTCTGTGCTGGATT
T
CTGGAAGGAAATTACGATGCCTGCAGGGGTGATTCTGGGGGACCATTGGTTATAAGAGACAACAAAGAT
ACC
TGGTATCTCATTGGAATTGTGAGCTGGGGAGACAACTGTGGTCAAAAGAACAAGCCTGGGGTGTACA
CA
CAAGTGACTTATTACCGACACTGGATTGCTTCGAAAACGGGTCTCTAA


Translation (389 aa):
MEVAGYGTHNRDLKQWMVTLLSALSLMMVVVTIGLLALFLVFDIQVNSNSGQKSSNQLKDLQETNENLVD
E
IFIDSALNNRYIKNHVVGL
TPEEDDTKADIVMVFQPPATGRRTVGKKTHHSILDQKTRNARALPADVSL
V
QVK
DCGKRAIPLIANRIVSGNPAAKGAWPWQVSLQRSNIHQCGGTLIGNMWVVTAAHCFRTNSNPRQWT
L
SFGTTINPPLMKRDVRRIIMHERYRPPARDHDIALVQFSPRVTFSDEVRRICLPEPSASFPPNSTVYIT
G
FGALYYG
GESQNELREARVQIISNDICKKRHVYGNEIKRGMFCAGFLEGNYDACRGDSGGPLVIRDNKD
T
WYLIGIVSWGDNCGQKNKPGVYTQVTYYRHWIASKTGL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser