NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23559.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23559.1 Public Mus musculus 9 Cdc25a 16 104 75 CCDS HistoryNCBI Gene:12530Re-query CCDS DB by CCDS ID:23559.1Re-query CCDS DB by GeneID:12530

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 23559.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000094324 ENSMUSP00000091882 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000094324Link to Ensembl Protein Viewer:ENSMUSP00000091882Re-query CCDS DB by Nucleotide ID:ENSMUST00000094324Re-query CCDS DB by Protein ID:ENSMUSP00000091882
Original member Current member NCBI NM_007658.3 NP_031684.3 Accepted alive Link to Nucleotide Sequence:NM_007658.3Link to Protein Sequence:NP_031684.3Re-query CCDS DB by Nucleotide ID:NM_007658Re-query CCDS DB by Protein ID:NP_031684Link to BLink:NP_031684.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031684.3 514 P48964 514 100% 0 0

Chromosomal Locations for CCDS 23559.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

Chromosome Start Stop Links
9 109875990 109876159 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 109877161 109877234 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 109878268 109878310 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 109879231 109879267 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 109879834 109879935 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 109881473 109881577 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 109883489 109883614 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 109884119 109884193 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 109884343 109884510 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 109887248 109887346 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 109888874 109888936 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 109889032 109889130 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 109889711 109889841 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 109891745 109891856 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 109892079 109892219 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1545 nt):
ATGGAACTGGGCCCGGAGCCCCCCCACCGCCGCCGCCTGTTCTTCGCTTGCAGCCCCACGCCTGCGCCGC
AG
CCCACGGGGAAGATGCTGTTTGGCGCGTCAGCTGCTGGCGGACTGTCCCCTGTCACCAACCTGACGGT
C
ACCATGGACCAGCTGGAAGGACTGGGCAGTGACTGTGAGAAAATGGAAGTGAGAAATAACAGCAGTCTA
CAG
AGAATGGGCTCCTCAGAATCGACCGATTCAGGTTTCTGTCTAGATTCTCCTGGGCCCTTGGACAGTA
AA
GAAAACCTTGAAATTTCCCTGACGAGAATAAATTCCCTACCTCAGAAGCTCCTGGGATGTAGCCCAGC
C
CTGAAGAGGAGCCACTCTGATTCTCTAGACCACGACACCTTTCACCTCATCGACCAGGATGAAAATAAA
GAA
AATGAAGCATTTGAATTTAAAAAGCCAATACGACCTGCATCTCGTCACATCTACGAGGAGAGTAAAG
AT
CCCTTTACACACAGGCAGAATTCAGCCCCAGCTCGGATGCTATCTTCAAATGAAAGTGAATCAGGAAA
T
TTCAGTCCTCTTTTTATACCCCAGTCACCTGTAAAAGCCACTTTGTCCGATGAGGATGATGGCTTCATA
GAC
CTTCTGGATGGCGAGAATATGAAGAATGATGAGGAGACCCCATCATGCATGGCAAGCCTCTGGACAG
CT
CCCCTTGTCATGAGGAGACCTGCAAACCTTGCCGATCGTTGCGGGCTGTTTGACTCCCCTTCCCCGTG
C
GGCTCCAGCACTCGGGCGGTGTTGAAGAGAGCAGACCGGTCTCACGAGGAGCCTCCTCGGGGTACAAAG
AGG
AGGAAGAGTGTGCCCAGCCCTGTGAAGGCGAAGGCGGATGTTCCGGAGCCCGCCCAGCTTCCATCCC
AG
TCTCTATCCCTGATGTCTTCCCCCAAAGGAACCATTGAGAACATTTTGGACAGTGACCCAAGAGACCT
T
ATAGGAGATTTCTCCAAGGGTTATCTCTTTAATACAGTCTCTGGGAAGCATCAGGATTTGAAATATATT
TCT
CCAGAAATTATGGCATCTGTTTTGAATGGCAAGTTTGCCGGTCTCATTAAAGAGTTTGTTATCATTG
AC
TGCCGATACCCATATGAGTATGAAGGAGGTCACATCAAGGGTGCCGTGAATCTGCACATGGAAGAAGA
G
GTTGAAGACTTCTTACTTAAGAACCCTATTGTGCCTACTGATGGCAAGCGTGTCATTGTCGTGTTCCAC
TGT
GAGTTTTCCTCTGAAAGAGGCCCTCGAATGTGCCGATATGTGAGAGAGAGAGATAGGCTCGGCAATG
AG
TACCCCAAGCTCCACTACCCTGAGCTGTATGTCCTGAAGGGGGGATACAAGGAGTTCTTTTTGAAGTG
C
CAGTCTCACTGTGAACCCCCCAGCTACCGGCCAATGCACCATGAAGACTTTAAAGAAGACCTAAAGAAG
TTC
CGCACCAAGAGCCGGACCTGGGCAGGAGAAAAGAGCAAAAGAGAGATGTACAGTCGCCTGAAGAAGC
TC
TGA


Translation (514 aa):
MELGPEPPHRRRLFFACSPTPAPQPTGKMLFGASAAGGLSPVTNLTVTMDQLEGLGSDCEKMEVRNNSSL
Q
RMGSSESTDS
GFCLDSPGPLDSKENLEISLTRINSLPQKLLGCSPALKRSHSDSLDHDTFHLIDQDENK
E
N
EAFEFKKPIRPASRHIYEESKDPFTHRQNSAPARMLSSNESESGNFSPLFIPQSPVKATLSDEDDGFI
D
LLDGENMK
NDEETPSCMASLWTAPLVMRRPANLADRCGLFDSPSPCGSSTRAVLKRADRSHEEPPRGTK
R
RKSVPSPVKAKADVPEPAQ
LPSQSLSLMSSPKGTIENILDSDPRDLIGDFSKGYLFNTVSGKHQDLKYI
S
PEI
MASVLNGKFAGLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKNPIVPTDGKRVIVVFH
C
EFSSERGPR
MCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFLKCQSHCEPPSYRPMHHEDFKEDLKK
F
RTKSRTWAGEKSKREMYSRLKKL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser