NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS56759.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56759.1 Public Mus musculus 11 Ogdh 16 104 75 CCDS HistoryNCBI Gene:18293Re-query CCDS DB by CCDS ID:56759.1Re-query CCDS DB by GeneID:18293

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Sequence IDs included in CCDS 56759.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000081894 ENSMUSP00000080569 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000081894Link to Ensembl Protein Viewer:ENSMUSP00000080569Re-query CCDS DB by Nucleotide ID:ENSMUST00000081894Re-query CCDS DB by Protein ID:ENSMUSP00000080569
Original member Current member EBI,WTSI OTTMUST00000001536 OTTMUSP00000000737 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000001536Link to Vega Protein Viewer:OTTMUSP00000000737Re-query CCDS DB by Nucleotide ID:OTTMUST00000001536Re-query CCDS DB by Protein ID:OTTMUSP00000000737
Original member Current member NCBI NM_001252288.1 NP_001239217.1 Accepted alive Link to Nucleotide Sequence:NM_001252288.1Link to Protein Sequence:NP_001239217.1Re-query CCDS DB by Nucleotide ID:NM_001252288Re-query CCDS DB by Protein ID:NP_001239217Link to BLink:NP_001239217.1

Chromosomal Locations for CCDS 56759.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

Chromosome Start Stop Links
11 6296978 6297199 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6313788 6313979 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6316765 6316855 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6334533 6334648 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6338558 6338712 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6339109 6339255 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6339838 6339928 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6340443 6340622 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6342495 6342623 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6346515 6346694 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6347098 6347250 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6347829 6347931 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6348235 6348363 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6348658 6348808 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6349100 6349227 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6349315 6349493 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6349842 6349913 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6350606 6350734 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6352126 6352198 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6354929 6355092 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6355291 6355445 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 6355554 6355674 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3060 nt):
ATGTTTCATTTAAGGACTTGTGCTGCTAAGTTAAGGCCATTGACAGCCTCCCAGACTGTTAAGACATTTT
CA
CAAAACAAACCAGCAGCAATTAGGACGTTTCAACAGATTCGGTGCTATTCTGCACCTGTAGCTGCTGA
A
CCATTTCTTAGTGGGACTAGTTCGAACTATGTGGAGGAAATGTACTGTGCCTGGTTGGAGAATCCCAAA
AGT
GTACATAAGTCATGGGACATTTTTTTCCGAAACACCAATGCTGGAGCCCCACCGGGCACTGCCTACC
AG
AGCCCCCTTTCCCTGAGTCGAAGCTCCCTGGCTACCATGGCCCATGCACAGTCCCTGGTGGAAGCACA
A
CCTAACGTCGACAAACTCGTGGAGGACCACTTGGCGGTGCAGTCTCTCATCAGGGCATATCAGGTCAGG
GGT
CACCACATTGCAAAACTTGATCCTCTCGGAATTAGTTGTGTAAATTTTGATGATGCTCCGGTAACTG
TT
TCTTCAAACGTGGGGTTCTATGGCCTACACGAGTCTGACCTTGACAAGGTCTTCCACTTACCCACCAC
C
ACTTTCATCGGGGGACAGGAGCCAGCACTTCCTCTTCGGGAGATCATCCGTCGGCTGGAGATGGCCTAC
TGC
CAGCACATTGGTGTGGAGTTCATGTTCATTAATGATTTGGAACAATGCCAGTGGATCCGACAGAAGT
TT
GAGACCCCTGGAATCATGCAGTTCACCAATGAGGAGAAGCGGACCTTGCTGGCCAGGCTTGTACGATC
C
ACCAGGTTTGAGGAGTTCCTACAGCGAAAGTGGTCCTCGGAGAAGCGTTTTGGTCTGGAAGGCTGTGAG
GTG
CTGATCCCTGCCCTCAAGACAATCATTGATATGTCAAGTGCAAATGGAGTGGACTATGTGATCATGG
GG
ATGCCACACAGAGGACGGCTGAACGTGCTTGCAAATGTCATCAGGAAGGAGCTGGAGCAAATATTCTG
T
CAGTTTGACTCAAAGCTGGAGGCAGCTGATGAGGGTTCTGGGGACATGAAGTACCACCTGGGCATGTAT
CAC
CGCAGGATCAACCGTGTGACCGACAGAAACATCACTTTGTCCTTGGTGGCTAACCCTTCCCATCTAG
AG
GCTGCTGACCCTGTCGTGATGGGAAAGACCAAAGCTGAACAGTTCTACTGTGGAGACACTGAAGGGAA
A
AAGGTGATGTCTATCCTGCTGCATGGGGATGCTGCTTTTGCTGGCCAGGGCATCGTATATGAGACCTTC
CAT
CTCAGCGACTTGCCGTCCTACACAACCCATGGCACTGTTCATGTGGTTGTCAACAACCAGATTGGCT
TC
ACCACAGACCCTCGGATGGCCCGCTCCTCTCCCTACCCCACTGATGTGGCCCGAGTGGTGAATGCCCC
C
ATTTTCCATGTCAACTCAGATGACCCTGAAGCTGTCATGTATGTATGCAAGGTGGCAGCTGAGTGGAGA
AAC
ACCTTCCACAAGGATGTTGTAGTTGATCTGGTGTGTTATCGACGAAATGGCCACAATGAGATGGACG
AA
CCTATGTTTACACAGCCACTCATGTACAAGCAGATCCGCAAGCAGAAGCCTGTACTGCAGAAGTATGC
A
GAATTGCTAGTCTCCCAGGGTGTCGTCAATCAGCCTGAGTACGAGGAGGAAATCTCCAAGTATGATAAG
ATC
TGTGAGGAAGCATTTACCAGATCCAAAGATGAGAAGATCTTGCACATCAAGCACTGGCTGGATTCCC
CC
TGGCCTGGCTTTTTCACCCTGGATGGACAGCCCAGGAGCATGACCTGCCCCTCCACTGGCCTGGAGGA
G
GATGTCTTGTTCCACATTGGAAAGGTGGCCAGCTCTGTACCTGTGGAGAACTTTACTATCCATGGAGGG
CTG
AGCCGGATCTTGAAGACCCGCAGAGAGCTTGTGACGAACCGGACTGTGGACTGGGCCCTGGCAGAGT
AC
ATGGCATTTGGCTCACTGCTGAAGGAAGGCATCCATGTGCGGCTGAGTGGCCAGGATGTGGAGCGGGG
C
ACCTTCAGCCATCGCCACCATGTGCTCCATGATCAGAATGTTGACAAAAGAACCTGCATCCCCATGAAC
CAC
CTTTGGCCAAATCAGGCCCCTTACACTGTATGCAACAGCTCGCTGTCTGAGTACGGTGTCCTGGGCT
TT
GAGCTGGGCTTTGCCATGGCTAGCCCTAATGCTCTGGTTCTCTGGGAGGCCCAGTTTGGTGACTTCAA
C
AACATGGCACAGTGCATCATTGACCAGTTCATCTGCCCAGGACAGGCAAAGTGGGTGCGGCAGAATGGC
ATT
GTGCTCCTGCTGCCTCATGGCATGGAAGGCATGGGTCCCGAGCATTCCTCTGCCCGCCCAGAGCGGT
TT
CTGCAGATGTGCAATGATGACCCAGATGTCCTGCCTGACCTGCAGGAAGAAAACTTTGACATCAATCA
G
CTCTATGACTGCAACTGGATTGTTGTCAACTGTTCCACCCCTGGCAACTTCTTCCATGTGCTGCGACGA
CAG
ATCTTGCTGCCCTTCCGGAAGCCGTTAATCGTCTTCACTCCCAAATCCCTCCTGCGCCACCCTGAGG
CA
AGAACTAGCTTTGACGAGATGCTGCCAGGAACGCACTTCCAGCGTGTGATCCCAGAAAATGGACCTGC
A
GCTCAGGACCCACACAAAGTCAAGAGACTTCTCTTCTGCACTGGGAAGGTGTACTATGACCTCACCCGA
GAG
CGCAAAGCCAGGAACATGGAGGAGGAGGTGGCTATTACAAGGATTGAGCAGCTATCACCATTCCCCT
TT
GACCTCCTGCTGAAAGAGGCACAGAAGTATCCCAATGCTGAGCTGGCCTGGTGCCAGGAAGAGCACAA
G
AACCAAGGCTACTATGACTATGTCAAGCCAAGACTTCGTACCACCATTGACCGTGCTAAGCCTGTCTGG
TAT
GCTGGCCGAGACCCGGCAGCTGCTCCAGCCACTGGCAACAAGAAAACACACCTGACAGAGCTGCAGC
GC
TTTCTGGACACAGCCTTTGACCTGGACGCATTCAAGAAATTCTCTTAG


Translation (1019 aa):
MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPK
S
VHK
SWDIFFRNTNAGAPPGTAYQSPLSLSRSSLATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQVR
G
HHIAKLDPLGISCVNFDDAPVTVSSNV
GFYGLHESDLDKVFHLPTTTFIGGQEPALPLREIIRRLEMAY
C
QHIGVEFMFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRST
RFEEFLQRKWSSEKRFGLEGCE
V
LIPALKTIIDMSSANGVDYVIMGMPH
RGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDMKYHLGMY
H
RRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKK
VMSILLHGDAAFAGQGIVYETF
H
LSDLPSYTTHGTVHVVVNNQ
IGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWR
N
TFHKDVVVDL
VCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDK
I
CEEAFTRSKDEKILHIKHWLDSPWP
GFFTLDGQPRSMTCPSTGLEEDVLFHIGKVASSVPVENFTIHGG
L
SRILKTRRELVTNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTF
SHRHHVLHDQNVDKRTCIPMN
H
LWPNQAPYTVCNSSLSEYGVL
GFELGFAMASPNALVLWEAQFGDFNNMAQCIIDQFICPGQAKWVRQNG
I
VLLLPHGMEGM
GPEHSSARPERFLQMCNDDPDVLPDLQEENFDINQLYDCNWIVVNCSTPGNFFHVLRR
Q
ILLPFRKP
LIVFTPKSLLRHPEARTSFDEMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTR
E
RKARNMEEEVAITRIEQ
LSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTIDRAKPVW
Y
AGRDPAAAPATGNKKTHLTELQRFLDTAFDLDAFKKFS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser