NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29086.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29086.1 Public Mus musculus 18 B4galt6 16 104 75 CCDS HistoryNCBI Gene:56386Re-query CCDS DB by CCDS ID:29086.1Re-query CCDS DB by GeneID:56386See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 29086.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000070080 ENSMUSP00000066515 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000070080Link to Ensembl Protein Viewer:ENSMUSP00000066515Re-query CCDS DB by Nucleotide ID:ENSMUST00000070080Re-query CCDS DB by Protein ID:ENSMUSP00000066515
Original member Current member NCBI NM_019737.2 NP_062711.1 Accepted alive Link to Nucleotide Sequence:NM_019737.2Link to Protein Sequence:NP_062711.1Re-query CCDS DB by Nucleotide ID:NM_019737Re-query CCDS DB by Protein ID:NP_062711Link to BLink:NP_062711.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062711.1 382 Q9WVK5 382 100% 0 0

Chromosomal Locations for CCDS 29086.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 18Link to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 20688321 20688468 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 20688935 20689036 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 20689221 20689343 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 20692392 20692579 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 20700739 20700855 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 20706405 20706529 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 20720029 20720142 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 20727962 20728078 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 20745353 20745467 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1149 nt):
ATGTCTGCGCTCAAGCGGATGATGCGGGTCTCCAATCGCTCTCTGATTGCCTTCATCTTCTTCTTCTCCC
TC
TCCACGTCCTGTCTCTACTTCATCTATGTGGCTCCAGGCATCGCCAACACGTACCTCTTTATGGTACA
A
GCTAGAGGTATCATGCTGAGAGAGAATGTGAAAACAATTGGACACATGATCAGGCTGTATACCAATAAA
AAC
ACTACGCTCAACGGAACAGATTATCCTGAAGGCAATAATACAAGTGACTATCTTGTTCAAACAACAA
CG
TATCTTCCGCAAAACTTCACGTATTTGCCACACCTCCCCTGTCCAGAGAAGCTGCCTTACATGCGGGG
A
TTCCTCAGTGTCAATGTGAGTGAGATCAGTTTTGATGAAGTCCATCAGCTCTTCTCCAAGGACTCAGAG
ATT
GGGCCAGGAGGCCACTGGAGGCCCAAAGACTGCAAGCCCAGATGGAAGGTGGCAGTTCTCATCCCCT
TC
CGTAACCGCCATGAACATCTTCCGATTTTTTTCCTGCACCTGATTCCGATGCTCCAGAAACAGCGGCT
G
GAATTTGCCTTTTATGTCATCGAACAGACCGGCACACAACCATTCAATCGTGCGATGCTCTTTAATGTG
GGT
TTCAAAGAGGCCATGAAAGACAGAGCCTGGGACTGTGTGATCTTCCATGATGTGGATCATCTGCCTG
AA
AATGATCGGAACTACTACGGATGTGGAGAGATGCCGCGGCACTTTGCAGCGAAGCTGGACAAGTACAT
G
TACATTCTTCCCTATAAGGAGTTTTTTGGTGGGGTGAGTGGCCTGACGGTGGAGCAATTCAGGAAGATC
AAC
GGCTTTCCCAATGCCTTCTGGGGATGGGGAGGCGAGGACGATGACCTTTGGAACAGAGTTCACTACG
CC
GGCTACAATGTAACCCGGCCAGAAGGGGACTTGGGAAAATACATATCTATTCCTCATCACCATCGAGG
G
GAGGTACAGTTCCTAGGACGGTATAAATTACTTCGGTATTCCAAGGAGCGGCAGTACATCGATGGACTG
AAC
AATTTATTATACACACCCAAAATACTGGTTGATAGGCTGTATACAAATATATCTGTAAACCTCATGC
CA
GAATTAGCTCCAATTGAAGACTATTAA


Translation (382 aa):
MSALKRMMRVSNRSLIAFIFFFSLSTSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNK
N
TTLNGT
DYPEGNNTSDYLVQTTTYLPQNFTYLPHLPCPEKLPYMRGFLSVNVSEISFDEVHQLFSKDSE
I
GPGGHWRPKDCKPRWK
VAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNV
G
FKEAMKDRAWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMY
ILPYKEFFGGVSGLTVEQFRKI
N
GFPNAFWGWGGEDDDLWN
RVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRYKLLRYSKERQYIDGL
N
NLLYTPKILVDRLYTNISVNLMPELAPIEDY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser