NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18538.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18538.1 Public Mus musculus 4 Slc6a9 16 104 75 CCDS HistoryNCBI Gene:14664Re-query CCDS DB by CCDS ID:18538.1Re-query CCDS DB by GeneID:14664See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 18538.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000030269 ENSMUSP00000030269 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000030269Link to Ensembl Protein Viewer:ENSMUSP00000030269Re-query CCDS DB by Nucleotide ID:ENSMUST00000030269Re-query CCDS DB by Protein ID:ENSMUSP00000030269
Original member Current member EBI,WTSI ENSMUST00000063857 ENSMUSP00000066102 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000063857Link to Ensembl Protein Viewer:ENSMUSP00000066102Re-query CCDS DB by Nucleotide ID:ENSMUST00000063857Re-query CCDS DB by Protein ID:ENSMUSP00000066102
Original member Current member EBI,WTSI OTTMUST00000019609 OTTMUSP00000008988 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000019609Link to Vega Protein Viewer:OTTMUSP00000008988Re-query CCDS DB by Nucleotide ID:OTTMUST00000019609Re-query CCDS DB by Protein ID:OTTMUSP00000008988
Original member Current member EBI,WTSI OTTMUST00000019611 OTTMUSP00000008989 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000019611Link to Vega Protein Viewer:OTTMUSP00000008989Re-query CCDS DB by Nucleotide ID:OTTMUST00000019611Re-query CCDS DB by Protein ID:OTTMUSP00000008989
Original member Current member NCBI NM_008135.4 NP_032161.2 Accepted alive Link to Nucleotide Sequence:NM_008135.4Link to Protein Sequence:NP_032161.2Re-query CCDS DB by Nucleotide ID:NM_008135Re-query CCDS DB by Protein ID:NP_032161Link to BLink:NP_032161.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032161.2 633 P28571-1 633 100% 0 0

Chromosomal Locations for CCDS 18538.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 117843106 117843135 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117855875 117856031 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117856690 117856821 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117857203 117857473 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117863429 117863561 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117863689 117863823 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117863913 117864016 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117864405 117864642 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117864754 117864888 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117864998 117865097 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117865196 117865296 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117867759 117867929 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117868048 117868242 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1902 nt):
ATGGTAGGAAAAGGTGCCAAAGGGATGTTGAATGGTGCTGTGCCCAGCGAGGCCACCAAGAAGGACCAGA
AC
CTCACACGGGGCAACTGGGGCAACCAGATCGAGTTTGTACTGACGAGCGTGGGCTATGCCGTGGGCCT
G
GGCAATGTCTGGCGTTTCCCATACCTCTGCTATCGCAACGGGGGAGGAGCCTTCATGTTCCCCTACTTC
ATC
ATGCTGATCTTCTGCGGGATTCCTCTCTTCTTCATGGAGCTTTCCTTCGGCCAGTTTGCAAGCCAGG
GC
TGCCTGGGGGTCTGGCGGATCAGCCCCATGTTCAAAGGCGTGGGCTATGGTATGATGGTGGTGTCCAC
A
TACATTGGCATCTACTACAACGTGGTCATCTGCATCGCCTTCTACTACTTCTTCTCGTCCATGACGCAC
GTG
CTGCCCTGGGCGTACTGCAACAACCCCTGGAACACACCTGACTGTGCCGGTGTGCTGGACGCTTCCA
AC
CTCACCAATGGCTCCCGGCCCGCTGCCCTGTCTGGCAACCTGTCTCACCTGTTCAACTACACCTTGCA
A
AGGACCAGCCCCAGCGAGGAGTACTGGAGGCTGTATGTGCTGAAGCTGTCAGACGACATTGGAAACTTT
GGG
GAAGTGCGGCTTCCCCTCCTAGGCTGCCTCGGCGTCTCCTGGGTGGTTGTCTTCCTCTGTCTCATCC
GA
GGAGTCAAGTCTTCAGGGAAAGTGGTGTACTTCACGGCCACATTCCCCTATGTGGTGCTGACCATTCT
G
TTTGTTCGTGGAGTGACCCTGGAAGGAGCCTTCACGGGTATCATGTACTACCTGACCCCACAATGGGAC
AAG
ATCCTGGAGGCCAAGGTCTGGGGGGATGCAGCCTCTCAGATCTTCTATTCCCTGGGCTGTGCATGGG
GT
GGCCTCATCACCATGGCGTCCTACAACAAATTTCACAACAACTGCTACCGGGACAGCGTCATTATCAG
T
ATCACCAACTGTGCTACCAGCGTCTACGCCGGCTTCGTCATCTTCTCCATCCTGGGCTTCATGGCCAAT
CAC
CTGGGTGTGGATGTGTCTCGGGTGGCAGACCATGGGCCTGGGCTAGCTTTTGTCGCTTACCCTGAGG
CT
CTCACGCTGCTTCCCATCTCTCCACTCTGGTCCTTATTGTTTTTCTTCATGCTCATCTTGCTGGGGCT
G
GGTACTCAGTTCTGCCTCCTAGAGACCCTGGTCACTGCCATTGTGGATGAGGTAGGGAATGAGTGGATT
CTG
CAGAAGAAGACCTACGTGACCTTGGGCGTCGCTGTGGCTGGCTTCTTGCTGGGCATCCCCCTTACCA
GC
CAGGCAGGCATCTACTGGCTGCTGCTGATGGACAACTATGCAGCCAGCTTCTCCTTGGTTGTCATCTC
C
TGTATCATGTGTGTATCCATCATGTACATCTATGGGCACCGTAACTACTTCCAGGACATCCAGATGATG
CTA
GGATTTCCCCCGCCTCTCTTCTTCCAGATCTGTTGGCGCTTTGTTTCTCCGGCTATCATCTTTTTCA
TT
CTCATCTTCACGGTGATCCAGTACCGGCCAATCACCTACAACCACTACCAGTACCCAGGCTGGGCTGT
G
GCCATCGGCTTCCTCATGGCTTTGTCGTCTGTCATCTGCATCCCACTGTACGCGCTGTTCCAGCTCTGC
CGC
ACAGATGGGGACACACTTCTTCAGCGTTTGAAAAATGCCACAAAGCCAAGCAGAGACTGGGGCCCCG
CT
CTCCTGGAGCACCGGACTGGGCGCTACGCTCCCACTACAACCCCCTCTCCCGAAGACGGGTTTGAGGT
C
CAGCCACTGCACCCGGACAAGGCCCAGATTCCCATCGTGGGCAGTAACGGCTCCAGCCGCTTCCAGGAC
TCC
CGGATATGA


Translation (633 aa):
MVGKGAKGMLNGAVPSEATKKDQNLTRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYF
I
MLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFK
GVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTH
V
LPWAYCNNPWNTPDCAGVLDASNLTNGSRPAALSGNLSHLFNYTLQRTSPSEEYW
RLYVLKLSDDIGNF
G
EVRLPLLGCLGVSWVVVFLCLIRGVKSSGK
VVYFTATFPYVVLTILFVRGVTLEGAFTGIMYYLTPQWD
K
ILEAK
VWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMAN
H
LGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQ
FCLLETLVTAIVDEVGNEWI
L
QKKTYVTLGVAVAGFLLGIPLTSQ
AGIYWLLLMDNYAASFSLVVISCIMCVSIMYIYGHRNYFQDIQMM
L
GFPPPLFFQICWRFVSPAIIF
FILIFTVIQYRPITYNHYQYPGWAVAIGFLMALSSVICIPLYALFQLC
R
TDGDTLLQ
RLKNATKPSRDWGPALLEHRTGRYAPTTTPSPEDGFEVQPLHPDKAQIPIVGSNGSSRFQD
S
RI




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser