NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29757.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29757.1 Public Mus musculus 19 Acta2 16 104 75 CCDS HistoryNCBI Gene:11475Re-query CCDS DB by CCDS ID:29757.1Re-query CCDS DB by GeneID:11475

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 29757.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000039631 ENSMUSP00000048218 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000039631Link to Ensembl Protein Viewer:ENSMUSP00000048218Re-query CCDS DB by Nucleotide ID:ENSMUST00000039631Re-query CCDS DB by Protein ID:ENSMUSP00000048218
Original member Current member NCBI NM_007392.3 NP_031418.1 Accepted alive Link to Nucleotide Sequence:NM_007392.3Link to Protein Sequence:NP_031418.1Re-query CCDS DB by Nucleotide ID:NM_007392Re-query CCDS DB by Protein ID:NP_031418Link to BLink:NP_031418.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031418.1 377 P62737 377 100% 0 0

Chromosomal Locations for CCDS 29757.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

Chromosome Start Stop Links
19 34241667 34241810 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 34243317 34243498 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 34244912 34245103 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 34246078 34246239 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 34246652 34246736 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 34248424 34248534 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 34251730 34251858 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 34252425 34252553 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1134 nt):
ATGTGTGAAGAGGAAGACAGCACAGCCCTGGTGTGCGACAATGGCTCTGGGCTCTGTAAGGCCGGCTTCG
CT
GGTGATGATGCTCCCAGGGCTGTTTTCCCATCCATCGTGGGACGTCCCAGACATCAGGGAGTAATGGT
T
GGAATGGGCCAAAAAGACAGCTATGTGGGGGATGAAGCCCAGAGCAAGAGAGGGATCCTGACGCTGAAG
TAT
CCGATAGAACACGGCATCATCACCAACTGGGACGACATGGAAAAGATCTGGCACCACTCTTTCTATA
AC
GAGCTTCGTGTGGCCCCTGAAGAGCATCCGACACTGCTGACAGAGGCACCACTGAACCCTAAGGCCAA
C
CGGGAGAAAATGACCCAGATTATGTTTGAGACCTTCAATGTCCCCGCCATGTATGTGGCTATTCAGGCT
GTG
CTGTCCCTCTATGCCTCTGGACGTACAACTGGTATTGTGCTGGACTCTGGAGATGGTGTGACTCACA
AC
GTGCCTATCTATGAGGGCTATGCCCTGCCTCATGCCATCATGCGTCTGGACTTGGCTGGCCGAGATCT
C
ACCGACTACCTCATGAAGATCCTGACTGAGCGTGGCTATTCCTTCGTGACTACTGCCGAGCGTGAGATT
GTC
CGTGACATCAAGGAGAAGCTGTGCTATGTAGCTCTGGACTTTGAAAATGAGATGGCCACGGCCGCCT
CC
TCTTCCTCCCTGGAGAAGAGCTACGAACTGCCTGACGGGCAGGTGATCACCATTGGAAACGAACGCTT
C
CGCTGCCCAGAGACTCTCTTCCAGCCATCTTTCATTGGGATGGAGTCAGCGGGCATCCACGAAACCACC
TAT
AACAGCATCATGAAGTGTGATATTGACATCAGGAAGGATCTCTATGCTAACAACGTCCTGTCAGGGG
GT
ACCACCATGTACCCAGGCATTGCTGACAGGATGCAGAAGGAGATCACAGCCCTCGCACCCAGCACCAT
G
AAGATCAAGATCATTGCCCCTCCAGAACGCAAGTACTCTGTCTGGATCGGTGGCTCCATCCTGGCTTCG
CTG
TCTACCTTCCAGCAGATGTGGATCAGCAAACAGGAATACGACGAAGCTGGGCCCTCCATCGTCCACC
GC
AAATGCTTCTAA


Translation (377 aa):
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK
Y
PIEHGIITNWDDMEK
IWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA
V
LSLYASGRTT
GIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI
V
RDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFI
GMESAGIHETT
Y
NSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIK
IIAPPERKYSVWIGGSILAS
L
STFQQMWISKQEYDEAGPSIVHRKCF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser