NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23432.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23432.1 Public Mus musculus 9 Pik3cb 16 104 75 CCDS HistoryNCBI Gene:74769Re-query CCDS DB by CCDS ID:23432.1Re-query CCDS DB by GeneID:74769See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 23432.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000035037 ENSMUSP00000035037 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000035037Link to Ensembl Protein Viewer:ENSMUSP00000035037Re-query CCDS DB by Nucleotide ID:ENSMUST00000035037Re-query CCDS DB by Protein ID:ENSMUSP00000035037
Original member Current member EBI,WTSI OTTMUST00000049861 OTTMUSP00000023176 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049861Link to Vega Protein Viewer:OTTMUSP00000023176Re-query CCDS DB by Nucleotide ID:OTTMUST00000049861Re-query CCDS DB by Protein ID:OTTMUSP00000023176
Original member Current member NCBI NM_029094.3 NP_083370.2 Accepted alive Link to Nucleotide Sequence:NM_029094.3Link to Protein Sequence:NP_083370.2Re-query CCDS DB by Nucleotide ID:NM_029094Re-query CCDS DB by Protein ID:NP_083370Link to BLink:NP_083370.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_083370.2 1064 Q8BTI9 1064 100% 0 0

Chromosomal Locations for CCDS 23432.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 99039713 99039850 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99040921 99041053 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99042524 99042669 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99044745 99044868 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99046547 99046714 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99052305 99052383 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99053971 99054080 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99055342 99055520 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99060185 99060284 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99061731 99061874 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99062837 99062958 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99064020 99064208 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99065560 99065610 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99070241 99070371 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99071348 99071444 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99073579 99073830 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99088605 99088682 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99090150 99090320 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99093043 99093222 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99094440 99094663 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99101175 99101400 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 99105531 99105683 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3195 nt):
ATGCCTCCTGCTATGGCAGACAACCTTGACATCTGGGCAGTGGACTCACAGATTGCATCCGATGGCGCCA
TA
TCCGTCGATTTCCTTCTGCCCACCGGGATTTATATCCAGTTGGAAGTACCTCGGGAAGCTACCATTTC
T
TATATTAAACAGATGTTATGGAAGCAAGTTCACAACTACCCGATGTTTAACCTCCTCATGGACATTGAC
TCG
TATATGTTTGCATGTGTGAATCAAACTGCTGTATATGAGGAACTGGAAGACGAAACACGAAGACTTT
GT
GATGTCAGACCTTTTCTTCCAGTTCTCAAACTAGTGACTAGAAGCTGTGACCCCGCAGAAAAATTGGA
C
TCAAAAATTGGGGTTCTTATAGGAAAAGGTCTTCATGAGTTTGATGCCTTGAAGGATCCCGAAGTGAAT
GAA
TTTAGAAGAAAAATGCGCAAATTCAGTGAGGCCAAGATTCAGTCTCTGGTAGGGTTGTCTTGGATCG
AC
TGGCTAAAGCACACGTATCCGCCTGAGCACGAGCCGTCCGTCCTGGAGAACTTGGAAGATAAACTTTA
T
GGAGGAAAGCTGGTTGTGGCTGTGCACTTTGAAAATAGCCAGGATGTATTTAGTTTTCAAGTGTCTCCC
AAT
TTGAATCCTATAAAAATAAATGAATTGGCAATCCAGAAACGCCTCACTATTCGTGGAAAGGAAGATG
AA
GCTAGCCCCTGTGACTATGTGTTACAGGTCAGTGGGAGAGTGGAGTATGTGTTTGGCGATCATCCACT
A
ATTCAGTTCCAGTACATCCGGAATTGTGTGATGAATAGAACCCTGCCCCACTTCATCCTTGTGGAATGT
TGT
AAGATCAAGAAAATGTATGAACAAGAAATGATTGCCATAGAGGCTGCCATCAACCGAAACTCATCCA
AC
CTTCCTCTCCCTTTACCACCAAAGAAAACGCGAGTTATTTCTCATATCTGGGACAACAACAACCCTTT
C
CAAATTACCTTGGTTAAAGGAAATAAGCTTAATACAGAAGAAACTGTGAAAGTTCATGTCCGAGCTGGG
CTT
TTTCACGGAACCGAGCTCCTGTGTAAAACCGTCGTAAGCTCAGAGATATCAGGAAAGAACGACCATA
TT
TGGAATGAACAACTGGAATTTGATATTAATATTTGTGACTTACCAAGAATGGCTCGATTATGTTTTGC
T
GTTTATGCAGTTTTGGATAAAGTAAAAACGAAGAAATCAACAAAGACTATTAATCCCTCTAAGTATCAG
ACC
ATCAGGAAAGCCGGGAAAGTGCATTATCCTGTCGCATGGGTAAATACCATGGTTTTTGACTTCAAAG
GA
CAGCTGAGGTCTGGAGACGTCATATTGCATAGCTGGTCTTCGTTTCCTGATGAGCTGGAAGAAATGCT
G
AATCCCATGGGGACTGTGCAGACGAACCCATATGCTGAGAACGCCACCGCCTTGCACATTACGTTCCCA
GAG
AATAAGAAGCAGCCGTGTTATTATCCCCCCTTCGATAAGATCATTGAGAAGGCAGCTGAGCTTGCCA
GC
GGAGACAGTGCTAATGTGTCAAGTCGTGGTGGAAAAAAATTTCTTGCTGTGCTGAAAGAAATCTTGGA
C
AGGGACCCCCTGTCTCAGCTGTGTGAGAACGAAATGGACCTTATTTGGACTCTACGGCAAGACTGCCGA
GAA
AATTTCCCTCAGTCACTGCCAAAACTACTCTTGTCAATCAAGTGGAATAAACTTGAAGATGTTGCTC
AG
CTTCAGGCGCTCCTGCAGATATGGCCCAAACTGCCCCCCAGGGAAGCCCTGGAACTCCTGGATTTCAA
C
TATCCAGACCAGTATGTCCGGGAATACGCTGTAGGCTGCCTTCGACAGATGAGTGATGAAGAACTCTCT
CAG
TATCTTTTACAATTGGTGCAAGTTTTGAAATATGAGCCTTTTCTCGATTGTGCCCTCTCCAGATTCC
TA
TTAGAAAGAGCACTTGATAATCGGAGGATTGGGCAGTTTCTGTTTTGGCATCTTAGGTCAGAGGTGCA
C
ACTCCTGCTGTGTCCGTACAGTTTGGTGTCATCCTGGAAGCATACTGTCGAGGAAGCGTGGGGCACATG
AAA
GTGCTTTCCAAACAGGTGGAAGCACTCAATAAGTTAAAAACTTTAAATAGCTTAATCAAACTGAATG
CG
GTGAAGCTGAGCAGAGCTAAGGGAAAGGAGGCCATGCACACGTGCCTGAAACAGAGTGCTTACCGGGA
G
GCGCTCTCTGACCTGCAGTCGCCGCTGAACCCCTGCGTCATCCTCTCAGAGCTCTATGTTGAAAAGTGC
AAA
TACATGGACTCCAAGATGAAGCCCCTGTGGCTGGTCTACAGCAGCAGAGCCTTTGGAGAGGACTCGG
TT
GGAGTGATCTTTAAAAATGGTGACGATTTGCGGCAGGACATGCTGACGCTGCAGATGTTGCGCCTGAT
G
GATCTGCTTTGGAAAGAAGCTGGCTTGGACCTGCGGATGCTCCCCTATGGCTGCTTAGCAACAGGAGAT
CGC
TCTGGCCTCATTGAGGTTGTGAGCACCTCTGAGACAATCGCTGACATTCAGCTGAACAGTAGTAACG
TG
GCTGCCACGGCAGCCTTCAACAAAGACGCACTCCTGAACTGGCTCAAGGAGTACAACTCTGGGGATGA
C
CTGGACCGAGCGATTGAGGAGTTTACCTTGTCCTGTGCTGGCTACTGTGTAGCCTCTTATGTCCTCGGC
ATT
GGTGACAGGCACAGTGACAACATCATGGTGAAGAAAACCGGCCAGCTCTTCCACATAGATTTTGGGC
AT
ATTCTTGGAAATTTCAAATCTAAATTTGGCATTAAAAGGGAGCGAGTACCTTTTATTCTTACTTATGA
C
TTCATTCATGTCATTCAACAAGGAAAAACGGGAAACACTGAAAAATTTGGCAGATTCCGCCAGTGCTGT
GAA
GATGCGTATCTGATTTTACGGCGGCATGGGAATCTCTTCATCACCCTGTTTGCCCTGATGTTGACTG
CA
GGGCTGCCTGAGCTCACATCGGTCAAAGATATACAGTATCTTAAGGACTCGCTTGCCTTAGGGAAGAG
C
GAGGAGGAAGCACTGAAGCAGTTCAAGCAGAAGTTTGACGAGGCCCTCAGGGAAAGCTGGACTACTAAA
GTG
AACTGGATGGCTCACACAGTACGGAAAGACTACAGGTCCTAG


Translation (1064 aa):
MPPAMADNLDIWAVDSQIASDGAISVDFLLPTGIYIQLEVPREATISYIKQMLWKQVHNYPMFNLLMDID
S
YMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPAEKLDSKIGVLIGK
GLHEFDALKDPEVN
E
FRRKMRKFSEAKIQSLVGLSWIDWLKHTYPPEHEPSVLENLEDKLYGGKLVVAVHFENSQ
DVFSFQVSP
N
LNPIKINELAIQKRLTIRGKEDEASPCDYVLQVSGRVEYVFGDHPLIQFQ
YIRNCVMNRTLPHFILVEC
C
KIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRVIS
HIWDNNNPFQITLVKGNKLNTEETVKVHVRAG
L
FHGTELLCKTVVSSEISGKNDHIWNEQLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTINPSKYQ
T
IRKAGKV
HYPVAWVNTMVFDFKGQLRSGDVILHSWSSFPDELEEMLNPMGTVQTNPYAENATALHITFP
E
NKKQPCYYPPFDK
IIEKAAELASGDSANVSSRGGKKFLAVLKEILDRDPLSQLCENEMDLIWTLRQDCR
E
NFPQSLPKLLLSIKWNKLEDVAQ
LQALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLRQMSDEELS
Q
YLLQLVQVLKYEPFLDCALSRFLLERALDNRRIGQFLFWHL
RSEVHTPAVSVQFGVILEAYCRGSVGHM
K
VLSKQ
VEALNKLKTLNSLIKLNAVKLSRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKC
K
YMDSKMKPLWLVYSSRAFGEDSVGVIFKNGD
DLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGD
R
SGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYNS
GDDLDRAIEEFTLSCAGYCVASYVLG
I
GDRHSDNIMVKKTGQ
LFHIDFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQGKTGNTEKFGRFRQCC
E
DAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLK
DSLALGKSEEEALKQFKQKFDEALRESWTTK
V
NWMAHTVRKDYRS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser