NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22405.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22405.1 Public Mus musculus 8 B3gnt3 16 104 75 CCDS HistoryNCBI Gene:72297Re-query CCDS DB by CCDS ID:22405.1Re-query CCDS DB by GeneID:72297

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 22405.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000034260 ENSMUSP00000034260 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000034260Link to Ensembl Protein Viewer:ENSMUSP00000034260Re-query CCDS DB by Nucleotide ID:ENSMUST00000034260Re-query CCDS DB by Protein ID:ENSMUSP00000034260
Original member Current member NCBI NM_028189.3 NP_082465.3 Accepted alive Link to Nucleotide Sequence:NM_028189.3Link to Protein Sequence:NP_082465.3Re-query CCDS DB by Nucleotide ID:NM_028189Re-query CCDS DB by Protein ID:NP_082465Link to BLink:NP_082465.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_082465.3 372 Q5JCS9 372 100% 0 0

Chromosomal Locations for CCDS 22405.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

Chromosome Start Stop Links
8 71692604 71693155 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 71693317 71693883 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1119 nt):
ATGCGGCTGCCAAGGCAGAGCCCCTACGAGATCCTCCTCCTGGTCTTGGTCGCCTTGCTGGTGCTGCTGC
TG
CTCCTGACCAGCAAGTCACCGCCCAGCTGCTCTGCCCCTGAGAGGTCCAAGGAGCCTGAAGACAACCC
C
GGGTGGGCCACGGGCCACCCACGCACACACCCCGCCCGGTGCCGAGCTAATCTATCCGTGTCCTCGCAC
CCC
GACTTCGCGGGGCTGCCCTTACACGTGCGCGACTTCTTGTTCTACCGCCACTGCCGCGACTTCCCAG
TG
CTCCGAGAGCCGCGGGTTACCAAGTGCGCGGAGCCCGTGTTCCTGCTGCTCGCCATCAAGTCCTCGCC
T
GCAAACTATGGGCGCCGCCAGATGCTGCGCACGACGTGGGCGCGCGAGAGACGGGTGCGTGGGGCGCCA
CTG
CGCCGCCTCTTCCTTGTGGGCTCAGACCGCGACCCACAACAAGCACGCAAATACAACCGACTGCTGG
AG
CTGGAAGCGCAGAAATACGGCGACATTCTCCAGTGGGATTTCCATGACTCCTTCTTTAACCTGACGCT
T
AAGCAGGTCCTTTTCCTGGAGTGGCAGCTAACCTACTGTACCAACGCCAGCTTCGTGCTCAATGGGGAC
GAC
GATGTGTTCGCACACACGGACAACATGGTCACCTACCTGCAGGACCACGACCCGGACCAACACCTCT
TC
GTGGGGCACCTGATCCAGAACGTGGGTCCCATCCGGGTGCCCTGGAGCAAGTACTTCATCCCCGCTCT
G
GTGATGGCGGAGGACAGATACCCGCCCTACTGTGGTGGCGGCGGCTTCCTGCTGTCGCGTTTTACCGTG
GCC
GCCCTACGTCGCGCCGCGCGCGTCCTCCCCATGTTCCCAATCGACGACGTGTTCCTGGGCATGTGTC
TG
CAGCAGCAGGGTCTGGCTCCCGGGACGCACAGCGGAGTGCGCACTGCGGGGGTTTTCCCCCCTAGCCC
A
CGTGTGTCATCCTTCGACCCCTGCTTCTACCGCGACCTGCTCCTCGTGCACCGCTTCCTGCCCTTCGAG
ATG
CTGCTGATGTGGGATGCGCTGAACCAGCCCCAGCTCCTCTGCGGCAGGCAGAGCCCCGCCTACTGA


Translation (372 aa):
MRLPRQSPYEILLLVLVALLVLLLLLTSKSPPSCSAPERSKEPEDNPGWATGHPRTHPARCRANLSVSSH
P
DFAGLPLHVRDFLFYRHCRDFPVLREPRVTKCAEPVFLLLAIKSSPANYGRRQMLRTTWARERRVRGAP
L
RRLFLVGSDRDPQQARKYNRLLELEAQKYGDILQWDFHDSFFNLTLKQ
VLFLEWQLTYCTNASFVLNGD
D
DVFAHTDNMVTYLQDHDPDQHLFVGHLIQNVGPIRVPWSKYFIPALVMAEDRYPPYCGGGGFLLSRFTV
A
ALRRAARVLPMFPIDDVFLGMCLQQQGLAPGTHSGVRTAGVFPPSPRVSSFDPCFYRDLLLVHRFLPFE
M
LLMWDALNQPQLLCGRQSPAY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser