NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21880.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21880.1 Public Mus musculus 7 Stx4a 16 104 75 CCDS HistoryNCBI Gene:20909Re-query CCDS DB by CCDS ID:21880.1Re-query CCDS DB by GeneID:20909See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 21880.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033075 ENSMUSP00000033075 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033075Link to Ensembl Protein Viewer:ENSMUSP00000033075Re-query CCDS DB by Nucleotide ID:ENSMUST00000033075Re-query CCDS DB by Protein ID:ENSMUSP00000033075
Original member Current member EBI,WTSI ENSMUST00000121705 ENSMUSP00000112927 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000121705Link to Ensembl Protein Viewer:ENSMUSP00000112927Re-query CCDS DB by Nucleotide ID:ENSMUST00000121705Re-query CCDS DB by Protein ID:ENSMUSP00000112927
Original member Current member EBI,WTSI OTTMUST00000076681 OTTMUSP00000040409 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000076681Link to Vega Protein Viewer:OTTMUSP00000040409Re-query CCDS DB by Nucleotide ID:OTTMUST00000076681Re-query CCDS DB by Protein ID:OTTMUSP00000040409
Original member Current member EBI,WTSI OTTMUST00000076682 OTTMUSP00000040410 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000076682Link to Vega Protein Viewer:OTTMUSP00000040410Re-query CCDS DB by Nucleotide ID:OTTMUST00000076682Re-query CCDS DB by Protein ID:OTTMUSP00000040410
Original member Current member NCBI NM_009294.3 NP_033320.1 Accepted alive Link to Nucleotide Sequence:NM_009294.3Link to Protein Sequence:NP_033320.1Re-query CCDS DB by Nucleotide ID:NM_009294Re-query CCDS DB by Protein ID:NP_033320Link to BLink:NP_033320.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033320.1 298 P70452 298 100% 0 0

Chromosomal Locations for CCDS 21880.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 127842039 127842068 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 127842264 127842365 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 127842445 127842544 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 127842684 127842758 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 127843572 127843642 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 127846020 127846128 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 127846200 127846276 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 127846488 127846625 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 127848388 127848498 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 127848569 127848652 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (897 nt):
ATGCGCGACAGGACCCACGAGTTGAGGCAGGGGGATAACATCTCAGACGATGAAGATGAGGTTCGAGTCG
CG
CTGGTGGTGCACTCAGGTGCTGCCCGGTTGGGCAGCCCGGACGACGAGTTCTTCCAGAAGGTGCAGAC
A
ATTCGGCAGACTATGGCCAAACTGGAGAGTAAAGTCCGGGAGTTGGAGAAACAGCAGGTCACCATCCTG
GCC
ACGCCTCTTCCCGAGGAGAGCATGAAGCAGGGCCTGCAGAACCTGCGAGAGGAGATCAAACAGCTGG
GG
AGAGAGGTCCGGGCGCAGCTAAAAGCCATAGAGCCCCAGAAGGAGGAAGCTGATGAGAATTACAACTC
A
GTCAACACAAGGATGAAGAAAACCCAGCATGGAGTCCTGTCCCAGCAATTTGTCGAGCTCATCAACAAG
TGC
AACTCAATGCAGTCCGAATACCGAGAGAAGAATGTGGAGCGGATCCGGAGGCAGCTGAAGATCACCA
AT
GCTGGAATGGTGTCTGACGAGGAGCTGGAACAGATGCTGGACAGTGGGCAGAGTGAGGTGTTTGTGTC
T
AATATCCTGAAGGACACGCAGGTGACTCGGCAGGCCCTGAATGAGATCTCTGCGCGGCACAGTGAGATC
CAG
CAGTTGGAGCGCAGTATCCGAGAGCTCCATGAGATCTTTACGTTTCTAGCTACGGAGGTGGAGATGC
AG
GGGGAGATGATCAACCGCATCGAGAAGAACATCCTGAGCTCGGCCGACTACGTGGAACGTGGGCAAGA
G
CACGTCAAGATAGCCCTAGAGAATCAGAAGAAGGCGAGGAAGAAAAAAGTCATGATTGCCATCTGTGTC
TCT
GTCACTGTTCTCATCTTGGCTGTCATCATTGGCATCACCATAACCGTTGGATAA


Translation (298 aa):
MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLGSPDDEFFQKVQTIRQTMAKLESKVRELEKQQVTIL
A
TPLPEE
SMKQGLQNLREEIKQLGREVRAQLKAIEPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINK
C
NSMQSEYREKNVERIRRQLKI
TNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEI
Q
QLERSIRELHEIFTFLATEVEMQ
GEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICV
S
VTVLILAVIIGITITVG




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser